US08476990B2
Embodiments are related to micro-electromechanical system (MEMS) devices, systems and methods. In one embodiment, a MEMS resonating device comprises a resonator element configured to provide timing; and at least one passive temperature compensation structure arranged on the resonator element.
US08476982B2
A method and device for managing a reference oscillator within a wireless device is presented. The method includes selecting reference oscillator parameters associated with the lowest reference oscillator error, where the selection is based upon reference oscillator parameters derived using different technologies within a wireless device, acquiring a satellite based upon the selected reference parameters, determining the quality of the satellite-based position fix, and updating the reference oscillator parameters based upon the quality of the satellite-based position fix. The wireless device includes a wireless communications system, a satellite positioning system (SPS) receiver, a reference oscillator connected to the wireless communications system and SPS receiver, and a mobile controller connected to the reference oscillator, SPS, and wireless communications system, and a memory connected to the mobile controller, where the memory stores a reference oscillator parameter table and instructions causing the mobile controller to execute the aforementioned method.
US08476975B2
An operational amplifying device comprises an input stage and an output stage. The input stage receives and processes an input voltage to output an amplified voltage. The output stage is electrically connected to the input stage in series. The output stage comprises a first switch and a second switch. The first switch is configured to turn on for transferring the amplified voltage. The second switch is connected in parallel with the first switch and is configured to turn on for transferring the amplified voltage. The second switch is turned off when the first switch is turned on such that the amplified voltage is transferred through the first switch to the first resistor array for gamma correction.
US08476963B2
An exponential multistage charge pump is provided wherein node voltages in a pumpcell in one stage of the charge pump are used to control operation of clock drivers in a subsequent stage of the charge pump.
US08476961B2
A system and method are provided for biasing transistor switches in a semiconductor based high power switch. Off-state Vgsd biasing for the off transistor switches is based upon acceptable levels of spurious harmonic emissions and linearity.
US08476934B2
Differential signal detection circuitry with an integrated reference voltage. The reference voltage is added as an offset to the output voltage, and its integration ensures that variations in the reference voltage closely track variations in the signal. Accordingly, the detection threshold for the signal being detected remains more consistent over variations in the circuit manufacturing process, power supply voltage and operating temperature.
US08476933B2
A receiver circuit of a semiconductor apparatus includes a first sense amplifier, a level restriction unit, and a second sense amplifier. The first sense amplifier amplifies an input signal in response to a clock signal and generates a first signal with a voltage swing between a first level and a second level. The level restriction unit receives the first signal and generates a correction signal with a voltage swing between the first level and a third level. The second sense amplifier amplifies the correction signal in response to the clock signal and generates a second signal with the voltage swing between the first level and the second level.
US08476925B2
Logic circuits based, at least in part, on use of spin-torque transfer (STT) to switch the magnetization—and hence the logic state—of a magnetic material are disclosed. Aspects of the invention include novel STT-based switching devices, new configurations of known STT-based devices into useful logic circuits, common logic circuits and system building blocks based on these new devices and configurations, as well as methods for inexpensively mass-producing such devices and circuits.
US08476920B2
In some embodiments an indication of an intended use of a logic device is stored in a register of the logic device, and any further programming of the register is prevented. Other embodiments are described and claimed.
US08476917B2
An embodiment of an electronic device includes a logic circuit, a switching element, and a quiescent current (IDDQ) evaluation circuit. The logic circuit is coupled to a first ground node. The switching element is coupled between the first ground node and a second ground node. The switching element is configurable in an electrically non-conductive state when the electronic device is in an IDDQ evaluation state, and in an electrically conductive state when the electronic device is not in the IDDQ evaluation state. When the electronic device is in the IDDQ evaluation state, the IDDQ evaluation circuit is configured to provide a first output signal when an IDDQ indicating voltage across the first and second ground nodes exceeds a reference voltage. Other embodiments include methods for producing an indication of IDDQ in an electronic device and methods for fabricating an electronic device with the capability of producing an IDDQ indication.
US08476913B2
A device (10) is disclosed that is suitable for testing an earth connection (30) that is isolated from a mains electricity supply. The device (10) comprises means (14, 40) for electrically connecting the device (10) to the earth connection (30), and means (16, 32) for electrically connecting the device (10) to an electrically conductive item (20) having a capacitance relative to an adjacent surface of the earth that is within a pre-determined range of capacitances. Furthermore, the device (10) includes means for generating an AC signal and delivering the AC signal to the electrically conductive item, and means for determining whether the resistance between the earth connection (30) and earth reference potential is less than a maximum earth resistance value. This determination is achieved by comparing the frequency of the generated AC signal with a pre-determined range of frequencies.
US08476907B2
An electronic device includes an internal device and a voltage tester. The internal device includes a power supply source input terminal. The voltage tester supplies one of first and second power supply source voltages to the power supply source input terminal of the internal device, in response to a test signal. The first and second power supply source voltages have different voltage levels. The first power supply source voltage has a voltage level within a normal range required for normal operations of the internal device. The second power supply source voltage has an abnormal voltage level outside the normal range.
US08476891B2
Provided is a constant current circuit capable of low current consumption operation, which is prevented from repeating a start-up state and a zero steady state and entering an oscillating state when power is activated. When power is activated, until a node (A) reaches a start-up state, an excitation current is continued to be supplied to a node (B), to thereby reliably start up the constant current circuit in a short period of time without repeating the start-up state and the zero steady state.
US08476889B2
A piezoelectric transformer driving device includes a piezoelectric transformer for outputting an alternating high voltage, a switching control part configured to control the control frequency of the control signal, a reference voltage waveform generation part configured to switch between a first voltage value, a second voltage value and a third voltage value, a monitor voltage generation part configured to generate a monitor voltage waveform based on the high voltage output from the piezoelectric transformer, and a comparison part configured to compare the reference voltage waveform with the monitor voltage waveform to generate a comparison result, and configured to supply the comparison result to the switching control part.
US08476881B2
A power control device for performing switching control for an output voltage of a power supply device includes a signal generation circuit for comparing a difference between a value of the output voltage and a value of a first reference voltage with a value of a second reference voltage, and for stopping the switching control when a value of the difference is less than or equal to the value of the second reference voltage, and an adjuster circuit for adjusting the second reference voltage based on a ratio between a value of an input voltage and the value of the output voltage.
US08476878B2
A startup circuit for use in a DC-DC converter having an input voltage terminal and an output voltage terminal, with the output voltage terminal connected to an output capacitor and with said converter including a pass transistor for transferring charge from the input terminal to the output terminal. The startup circuit includes a control circuit configured to cause the pass transistor to conduct an output current during start up when the output terminal voltage is approaching a final regulated voltage, with the output current being comprised of first and second current components, with the first current component being proportional to the output voltage and the second current component being proportional to the input voltage, with the two components being combined so as to resist changes in the power dissipation in the pass transistor during startup.
US08476865B2
A device controls charging a battery with power supplied from a power supply located outside of a vehicle through a charge cable. The device includes a first microcomputer and a second microcomputer. The first microcomputer is configured to turn on a charge mode signal upon detecting a change in a pilot signal output through the charge cable, and to turn off the charge mode signal when a charge completion signal output from the second microcomputer is turned off. The second microcomputer is configured to charge the battery through the charge cable when the charge mode signal is turned on, and to turn off the charge completion signal when the charging is complete. When the charge completion signal is turned on at the time of the first microcomputer turning off the charge mode signal due to sudden fluctuations, the charge mode signal is turned on again.
US08476864B2
A battery monitor for monitoring operations of a battery, such as but not limited to monitoring operations of a vehicle battery. The battery monitor may be configured to monitor current flow and battery temperature. The battery monitor may be connected to a cable used to electrically connect the battery to a number of electronic devices so that the battery monitor is located away from the battery. The battery monitor may include a processing element grounded directly to a negative pole of the battery to facilitate isolating the processing element from noise created by the electronic devices connected to the cable.
US08476860B2
An electric power converter includes a control unit outputting a PWM signal, a bridge circuit producing AC electric power supplied to a motor by turning semiconductor switching devices in the bridge on and off in response to PWM signals, a cut off unit cutting the PWM signals off from the bridge circuit in response to a gate signal, and a monitoring unit generating a test signal for checking the cut off unit. The cut off unit includes a switching circuit switching between the test signal and an external cut off signal, and a delay circuit that delays the output of the switching circuit. The arrangement enables the electric power converter to monitor as to whether the cut off unit is abnormal without stopping the operation of the electric power converter.
US08476856B2
A three-phase AC motor drive control device has a phase command calculation unit. When driving a three-phase AC motor by a three-phase alternating square-wave voltage that is converted in power according to a switching command corresponding to one cycle of the electrical angle obtained from a rotational position of the rotor of the three-phase AC motor, the phase command calculation unit performs a torque feedback calculation based on a torque deviation, obtains, based on this calculation result, a phase command that is the lead or lag angle amount of a phase to be corrected, and stores and updates this obtained phase command. To generate the switching command, the three-phase AC motor drive control device outputs a pulse pattern to an inverter, the pulse pattern being shifted in phase by the amount of the phase command with respect to the basic phase of the three-phase alternating square-wave voltage uniquely determined with respect to the one cycle of the electrical angle.
US08476851B2
A motor magnetic pole position correction method includes preventing a movement of a movable element of a direct drive motor by mechanical brake (step S9), generating a command that designates a position spaced or separated from the present position (step S10), detecting a torque command value of the direct drive motor (step S12), determining a magnetic pole position correction value based on a comparison between the detected torque command value and a predetermined threshold value (steps S14 and S16), storing the determined magnetic pole position correction value in a memory (step S18), and performing motor control using an electrical angle offset value obtained based on the magnetic pole position correction value stored in the memory.
US08476848B2
For providing a lamp lighting device and a filament lamp wherein a wire breakage of the filament lamp can be detected without an excessive consumption of power while the device as a whole is not enlarged, a filament lamp is provided comprising a light emission tube having at least one sealing portion and in the interior of which at least one filament is arranged, internal leads connected to both ends of said filament, metal foils for power supply provided in said at least one sealing portion of the light emission tube and connected to said internal leads, and external leads connected to said metal foils for power supply; wherein a metal foil for detection is provided in said sealing portion and is connected to one of a said internal lead and a said metal foil for power supply, and an external detection lead is provided at said metal foil for detection.
US08476847B2
A thermal-foldback system detects an over-temperature condition in an LED lamp. In response to the over-temperature condition, the thermal-foldback system chops a portion of the input power waveform drawn by the LED lamp.
US08476845B2
A brightness controller determines a lowest dimmer setpoint and an average power to a light source at the lowest dimmer setpoint. An average power supplied to the light source is set based on a setting of the dimmer relative to the average power at the lowest dimmer setpoint.
US08476843B2
A driving circuit for a single-string light-emitting diode (LED) lamp includes a push-pull converter. The push-pull converter converts an input low DC voltage (such as 12-19V) to a high DC voltage (such as above 200V) to supply power to the single-string LED lamp. The driving circuit controls a lamp current flowing through the single-string LED lamp by constant current and adjusts brightness of the single-string LED lamp by pulse-width modulation (PWM) dimming. In addition, the single-string LED lamp provides the standardization design for connectors of the driving circuit used to connect to the single-string LED lamp so that the driving circuit has a better common-use characteristic. Moreover, the driving circuit does not need a current balance circuit and only needs a cheaper and general-purpose integrated circuit to control the push-pull converter to reduce design cost of the driving circuit.
US08476834B2
The present invention relates to an automatic lighting control system, and more particularly, to an automatic lighting control system which is capable of predicting a movement route of a resident in a complex building and automatically controlling lighting located in the movement route. According to the present invention, it is possible to reduce power consumption by simplifying configuration of lamps and controlling luminance of lamps on a resident or vehicle movement route by predicting motion of the resident or the vehicle through centralized control for a plurality of lamps, and to provide increased movement convenience and emotional satisfaction of a resident by showing the resident a movement route through lamps and securing a field of view on the movement route.
US08476824B2
An active matrix organic electroluminescent device includes a thin-film transistor, an organic electroluminescent device, and a spacer layer deposited between the thin-film transistor and the organic electroluminescent device, wherein the spacer layer is made of adhesive for a dual curing system selected from the group consisting of ultraviolet curing-thermal curing, ultraviolet curing-microwave curing, ultraviolet curing-anaerobic curing, and ultraviolet curing-electron beam curing system. The present invention solves the poor adhesiveness between the thin-film transistor and the organic electroluminescent device, and improves the moisture and oxygen proof ability. The preparation method is simple, effective, and able to lower the cost and difficulty, and greatly improve the yield rate of the device.
US08476822B2
An organic light emitting device is provided. The device has a first electrode, a second electrode, and an emissive layer disposed between the first and second electrodes. The emissive layer includes an emissive material with an intrinsic emission spectrum having a peak emission wavelength in the visible spectrum less than 500 nm. The device includes a color saturation enhancement layer in direct contact with the first electrode. The color saturation enhancement layer consists essentially of one or more metals or conductive doped inorganic semiconductors, and has an index of refraction at least 0.2 different from that of the organic layers. The color saturation enhancement layer has a thickness of 1-10 nm. The reflectivity of the color saturation enhancement layer is in the range 5% to 30% for the peak wavelength in the intrinsic emission spectrum of the emissive material. Preferably, the color saturation enhancement layer is disposed between the first and second electrodes.
US08476817B2
The present invention provides a spark plug which is capable of suppressing a occurrence of crack and separation by determining a structural configuration of a melting portion formed in a junction portion between a discharge portion and a pedestal portion which form an ignition portion that protrudes from a ground electrode. In a profile line shape of a cross section including a center axis P of an ignition portion 80, an exposure surface 88 of a melting portion 83 connects a side surface 82 of a discharge portion 81 and a side surface 85 of a pedestal portion 84. Further, an exterior angle θ formed between an imaginary line Q, which passes through a boundary position X1 between the melting portion 83 and the pedestal portion 84 and a boundary position X2 between the melting portion 83 and the discharge portion 81, and the center axis P at a node C, satisfies 135°≦θ≦175°. Furthermore, a proportion T/S of a forming depth T of the melting portion 83 to an outside diameter S of the discharge portion 81 satisfies T/S≧0.5.
US08476816B2
A spark plug includes an inner conductor, an ignition tip connected to the inner conductor, an insulator surrounding the inner conductor and having a front end and a rear end, a spark plug body having a front end and a rear end, and at least one ground electrode connected to the front end of the spark plug body. The spark plug has a longitudinal direction extending parallel to the inner conductor. The spark plug body comprises a passage extending in the longitudinal direction and in which the insulator is disposed. A sleeve composed of metal is disposed between the insulator and the spark plug body. The sleeve is tightly connected to the insulator and the spark plug body and is referred to below as the “first sleeve”. At least one second sleeve is disposed at a distance from the first sleeve) and, in fact, between the first sleeve and the rear end of the insulator. The second sleeve is connected to the insulator and touches the spark plug body in the passage thereof.
US08476814B2
A light utilization efficiency of a high-pressure discharge lamp is improved even in a case of reducing the size of a reflection mirror without using an auxiliary reflection mirror. In a lamp device where a portion of lights emitted from a discharge bulb to the periphery thereof in forward and backward directions for a predetermined range of angle is reflected at a concave reflection mirror and illuminated to a light collection area of a predetermined size formed forward of the lamp, a prism surface having an angle of refracting or deflecting at least a portion of lights emitted from the discharge bulb that is not reflected at the concave reflection mirror to the light collection area is formed to the outer peripheral surface of the discharge bulb.
US08476811B2
To provide the piezoelectric device and the manufacturing method thereof, in which the quartz-crystal side surface electrodes and the base side surface electrodes are ensured to be electrically connected without disconnection. The piezoelectric device (100) comprises: a piezoelectric vibrating piece (21), an outer frame (22), a piezoelectric frame (20) for forming a first castellation (204), a package base (12) which is bonded by to the outer frame by adhesive (13) and which the second castellation is formed, and a package lid (11). The piezoelectric frame comprises: an excitation electrodes, a second extraction electrodes and a first side surface electrodes formed on the first castellation. The package base comprises: a second side surface electrode formed on the second castellation, and an external electrode. A pair of connection electrodes (14) is formed on the first castellation or second castellation, for electrically connecting the first side surface electrode or the first extraction electrode to the second side surface electrode.
US08476810B2
A piezoelectric device includes: a first substrate; a second substrate disposed opposed to the first substrate; a third substrate disposed between the first substrate and the second substrate, a part of the third substrate forming a piezoelectric oscillating piece, and another part of the third substrate forming a frame which surrounds the piezoelectric oscillating piece; a first metal film which joins the first substrate and the frame; a second metal film which joins the second substrate and the frame; and a resin portion provided at least at any one of positions between the first substrate and the first metal film, between the frame and the first metal film, between the second substrate and the second metal film, and between the frame and the second metal film.
US08476809B2
Devices having piezoelectric material structures integrated with substrates are described. Fabrication techniques for forming such devices are also described. The fabrication may include bonding a piezoelectric material wafer to a substrate of a differing material. A structure, such as a resonator, may then be formed from the piezoelectric material wafer.
US08476804B2
A piezoelectric drive type MEMS element includes: a first substrate including, in a portion thereof, a movable part which is driven by a piezoelectric drive section to be displaced in a convex shape, a movable electrode being provided on a surface of the movable part; and a second substrate which is bonded to the first substrate and supports a fixed electrode facing the movable electrode via a prescribed gap, wherein the piezoelectric drive section includes a piezoelectric film provided on a region of the first substrate which forms the movable part as a portion of the movable part, and a pair of electrodes disposed so as to sandwich the piezoelectric film.
US08476792B2
A voice coil motor includes a lens retainer, a wire, and an elastic electrode member. The lens retainer includes an end portion. The wire wraps around the lens retainer and includes a first end and a second end. The elastic electrode member is metal and is mounted to the end portion. The elastic member includes a first elastic metal sheet and a second elastic metal sheet. The first elastic metal sheet includes a first electrode. The second elastic plate is physically separated from the first elastic sheet and includes a second electrode. The first end and the second end are respectively soldered to the first electrode and the second electrode.
US08476780B2
Yaw control is performed such that a nacelle faces into an actual main wind direction. The actual wind direction is estimated by detecting the main wind direction with an anemoscope (wind direction detecting means), assuming the actual wind direction by assuming a wind direction offset value, which is a deviation between the main wind direction and the actual wind direction, which is a direction of wind which blows in actual use, at a predetermined wind speed with a wind direction assuming unit (wind direction assuming means), calculating an average generator output power for a predetermined period of time in the assumed actual wind direction with an average-generator-output-power calculation unit (average-generator-output-power calculation means), approximating the average generator output power with respect to the assumed wind direction offset value to a quadratic curve with an actual wind direction estimation unit (actual wind direction estimation means), and estimating the wind direction offset value at the time when the average generator output power is the maximum in the approximated quadratic curve to be an actual offset value.
US08476777B2
A starter includes an electromagnetic solenoid that generates force for pushing a pinion gear 6 to a ring gear side, and an electromagnetic switch that opens and closes a motor contact point. When idle-stop is performed, an ECU energizes a solenoid coil of the electromagnetic solenoid during inertial rotation until the ring gear stops rotating. After rotation of an engine is stopped, the ECU stops energizing the solenoid coil. As a result, in the starter, the pinion gear can mesh with the ring gear that is rotating by inertia without use of the rotational force of a motor. The meshed state can be maintained even after energization of the solenoid coil is stopped.
US08476763B2
Methods of forming conductive pattern structures form an insulating interlayer on a substrate that is partially etched to form a first trench extending to both end portions of a cell block. The insulating interlayer is also partially etched to form a second trench adjacent to the first trench, and a third trench extending to the both end portions of the cell block. The second trench has a disconnected shape at a middle portion of the cell block. A seed copper layer is formed on the insulating interlayer. Inner portions of the first, second and third trenches are electroplated with a copper layer. The copper layer is polished to expose the insulating interlayer to form first and second conductive patterns in the first and second trenches, respectively, and a first dummy conductive pattern in the third trench. Related conductive pattern structures are also described.
US08476760B2
Bond pads on an integrated circuit are provided with planarizing dielectric structures to permit the electroplating of metal posts having planar top surfaces. The metal posts contact at least three sides of the planarizing dielectric structures. The planarizing dielectric structures can be used on integrated circuits having bond pads of different sizes to electroplate metal posts having the same height.
US08476756B2
A semiconductor device includes a semiconductor element having a rectangular two-dimensional geometry and serving as a heat source, a first heat sink section including the semiconductor element mounted thereon, and a second heat sink section joined to an opposite side of the first heat sink section that includes the semiconductor element. A relation among directional components of thermal conductivity is K1yy≧K1xx>K1zz, where directional components of a three-dimensional thermal conductivity of the heat sink section in X, Y, and Z directions are determined as Kxx, Kyy, and Kzz. A relation among directional components of a thermal conductivity of the second heat sink section is K2zz≧K2yy>K2xx or K2yy≧K2zz>K2xx, where the directional components of the thermal conductivity of the second heat sink section in X, Y, and X directions are determined as K2xx, K2yy, and K2zz.
US08476754B2
There is provided a wiring substrate. The wiring substrate includes: an insulating layer; first electrode pads having first exposed surfaces, the first exposed surfaces being exposed from the insulating layer; and second electrode pads having second exposed surfaces, the second exposed surfaces being exposed from the insulating layer. There is a level difference between the first exposed surfaces and the second exposed surfaces.
US08476750B2
A package includes a printed circuit board (PCB) having a first side and a second side and a thickness between the first side and the second side and a stacked die including a top die mounted on a bottom die, the bottom die being at least partially embedded in the PCB. Also a method of forming a package that includes forming an opening in a top surface of the PCB layer, placing a stacked die including a top die stacked on a bottom die into the opening, laminating the PCB layer to form a laminate layer, and forming an electrical connection with the stacked die.
US08476742B2
Edges of a first conductive layer (104) and a silicate glass layer (106) extend adjacent one another along a via (164) extending to a semiconductor substrate (41). An electrical conductor (112/114) extends through the via (164) into contact with the semiconductor substrate (41).
US08476741B2
According to one embodiment, a semiconductor device includes: a substrate; an organic insulating film provided on the substrate; an inorganic insulating film formed thinner than the organic insulating film on the organic insulating film; a hollow sealing structure that is formed on the inorganic insulating film, and seals a MEMS element in an inside while ensuring a space between the hollow sealing structure itself and the MEMS element; a through hole formed so as to penetrate the organic insulating film and the inorganic insulating film; and a conductive member that is filled into the through hole, and electrically connects the MEMS element and an electrode formed by being filled into the through hole.
US08476735B2
Various structures of a programmable semiconductor interposer for electronic packaging are described. An array of semiconductor devices having various values is formed in the interposer. A user can program the interposer and form a “virtual” device having a desired value by selectively connecting various one of the array of devices to contact pads formed on the surface of the interposer. An inventive electronic package structure includes a standard interposer having an array of unconnected devices of various values and a device selection unit, which selectively connects various one of the array of devices in the standard interposer to an integrated circuit die encapsulated in the electronic package. Methods of forming the programmable semiconductor interposer and the electronic package are also illustrated.
US08476722B2
A magnetic memory device is provided. The magnetic memory device includes a first vertical magnetic layer and a second vertical magnetic layer on a substrate, a tunnel barrier layer between the first vertical magnetic layer and the second vertical magnetic layer, and an exchange-coupling layer between a first sub-layer of the first vertical magnetic layer and a second sub-layer of the first vertical magnetic layer.
US08476718B2
A semiconductor device includes a MISFET comprising: a semiconductor layer including a semiconductor region formed therein; a gate insulating film formed above the semiconductor region, and including a metal oxide layer containing a metal and oxygen, the metal contained in the metal oxide layer being at least one selected from Hf and Zr, the metal oxide layer further including at least one element selected from the group consisting of Ru, Cr, Os, V, Tc, and Nb, the metal oxide layer having sites that capture or release charges formed by inclusion of the element, density of the element in the metal oxide layer being in the range of 1×1015 cm−3 to 2.96×1020 cm−3, the sites being distributed to have a peak closer to the semiconductor region than to a center of the metal oxide layer; and a gate electrode formed on the gate insulating film.
US08476711B2
A gate controlled fin resistance element for use as an electrostatic discharge (ESD) protection element in an electrical circuit has a fin structure having a first connection region, a second connection region and a channel region formed between the first and second connection regions. Furthermore, the fin resistance element has a gate region formed at least over a part of the surface of the channel region. The gate region is electrically coupled to a gate control device, which gate control device controls an electrical potential applied to the gate region in such a way that the gate controlled fin resistance element has a high electrical resistance during a first operating state of the electrical circuit and a lower electrical resistance during a second operating state, which is characterized by the occurrence of an ESD event.
US08476693B2
In one embodiment, a nonvolatile semiconductor memory includes a memory cell array, a first silicon nitride film and a second silicon nitride film. The memory cell array includes NAND cell units. Each of the NAND cell units has memory cell transistors, a source-side select gate transistor and a drain-side select gate transistor. The source-side select gate transistors is disposed in such a manner as to face each other and the drain-side select gate transistors is disposed in such a manner as to face each other. The first silicon nitride film is present in a region between the source-side select gate transistors and is disposed at a position lowest from the upper surface of the semiconductor substrate. The second silicon nitride film is formed in a region between the drain-side select gate transistors and is disposed at a position lowest from the upper surface of the semiconductor substrate.
US08476690B2
A nonvolatile programmable logic switch according to an embodiment includes: a first semiconductor region of a first conductivity type and a second semiconductor region of a second conductivity type; a memory cell transistor including a first insulating film formed on the first semiconductor region, a charge storage film formed on the first insulating film, a second insulating film formed on the charge storage film, and a control gate formed on the second insulating film; a pass transistor including a third insulating film formed on the second semiconductor region, and a gate electrode formed on the third insulating film and electrically connected to the first drain region; a first electrode applying a substrate bias to the first semiconductor region, the first electrode being formed in the first semiconductor region; and a second electrode applying a substrate bias to the second semiconductor region, the second electrode being formed in the second semiconductor region.
US08476679B2
A dynamic and end-user configurable controlled impedance interconnect line includes a plurality of conductive pixels, a plurality of thin-film transition material interconnects to electrically connect adjacent conductive pixels in the plurality of conductive pixels, and a plurality of addressable pixel interconnect actuators to selectively heat a respective plurality of the thin-film transition material interconnects. The plurality of addressable pixel interconnect actuators is operable to selectively heat a respective plurality of the thin-film transition material interconnects to form an interconnect line.
US08476678B2
A CMOS device with transistors having different gate dielectric materials and a method of manufacture thereof. A CMOS device is formed on a workpiece having a first region and a second region. A first gate dielectric material is deposited over the second region. A first gate material is deposited over the first gate dielectric material. A second gate dielectric material comprising a different material than the first gate dielectric material is deposited over the first region of the workpiece. A second gate material is deposited over the second gate dielectric material. The first gate material, the first gate dielectric material, the second gate material, and the second gate dielectric material are then patterned to form a CMOS device having a symmetric Vt for the PMOS and NMOS FETs.
US08476659B2
The present disclosure relates to methods for performing wafer-level measurement and wafer-level binning of LED devices. The present disclosure also relates to methods for reducing thermal resistance of LED devices. The methods include growing epitaxial layers consisting of an n-doped layer, an active layer, and a p-doped layer on a wafer of a growth substrate. The method further includes forming p-contact and n-contact to the p-doped layer and the n-doped layer, respectively. The method further includes performing a wafer-level measurement of the LED by supplying power to the LED through the n-contact and the p-contact. The method further includes dicing the wafer to generate diced LED dies, bonding the diced LED dies to a chip substrate, and removing the growth substrate from the diced LED dies.
US08476645B2
Thermal management solutions for higher power LEDs. In accordance with embodiments, a heat sink, preferably copper, is connected directly to the thermal pad of an LED. Directly connecting the LED thermal pad to the copper heat sink reduces the thermal resistance between the LED package and the heat sink, and more efficiently conducts heat away from the LED through the copper heat sink. In embodiments, the copper heat sink is directly soldered to the LED thermal pad.
US08476638B2
An object of the present invention is to provide a technique for manufacturing a dense crystalline semiconductor film without a cavity between crystal grains. A plasma region is formed between a first electrode and a second electrode by supplying high-frequency power of 60 MHz or less to the first electrode under a condition where a pressure of a reactive gas in a reaction chamber of a plasma CVD apparatus is set to 450 Pa to 13332 Pa, and a distance between the first electrode and the second electrode of the plasma CVD apparatus is set to 1 mm to 20 mm; crystalline deposition precursors are formed in a gas phase including the plasma region; a crystal nucleus of 5 nm to 15 nm is formed by depositing the deposition precursors; and a microcrystalline semiconductor film is formed by growing a crystal from the crystal nucleus.
US08476636B2
Provided may be a Poly-Si thin film transistor (TFT) and a method of manufacturing the same. The Poly-Si TFT may include a first Poly-Si layer on an active layer formed of Poly-Si and doped with a low concentration; and a second Poly-Si layer on the first Poly-Si layer and doped with the same concentration as the first Poly-Si layer or with a higher concentration than the first Poly-Si layer, wherein lightly doped drain (LDD) regions capable of reducing leakage current may be formed in inner end portions of the first Poly-Si layer.
US08476630B2
A pattern of conductive ink is disposed on the topside of the unsingulated integrated circuits of a wafer, and, typically after wafer probing, the pattern of conductive ink is removed. The conductive ink pattern provides an electrical pathway between bond pads on an integrated circuit and large contact pads disposed on the topside of the integrated circuit. Each of the large contact pads is much greater in area than the corresponding bond pads, and are spaced apart so that the pitch of the large contact pads is much greater than that of the bond pads. In one aspect of the present invention, the conductive ink includes a mixture of conductive particles and wafer bonding thermoset plastic. In another aspect of the present invention, the conductive ink is heated and disposed on a wafer by an ink jet printing system.
US08476623B2
A light emitting device having a plastic substrate is capable of preventing the substrate from deterioration with the transmission of oxygen or moisture content. The light emitting device has light emitting elements formed between a lamination layer and an inorganic compound layer that transmits visual light, where the lamination layer is constructed of one unit or two or more units, and each unit is a laminated structure of a metal layer and an organic compound layer. Alternatively, each unit is a laminated structure of a metal layer and an organic compound layer, wherein the inorganic compound layer is formed so as to cover the end face of the lamination layer. In the present invention, the lamination layer is formed on the primary surface of the plastic substrate, so that a flexible substrate structure can be obtained.
US08476619B2
A semiconductor device includes a gate formed over a substrate, organic semiconductor pattern interposed between the substrate and the gate, junction regions formed in the substrate on both sides of the gate, and junction patterns formed over the junction regions to contact the organic semiconductor patterns.
US08476614B2
A memory device that includes a resistive-change memory element, the memory device includes: a first memory element that includes a first resistive-change layer and a first electrode connected to the first resistive-change layer; and a second memory element that includes a second resistive-change layer and a second electrode connected to the second resistive-change layer, wherein at least one of the thickness and the material of the second resistive-change layer and the area of the second electrode in contact with the second resistive-change layer is different from the corresponding one of the thickness and the material of the first resistive-change layer and the area of the first electrode in contact with the first resistive-change layer.
US08476611B2
This application relates to systems and methods for the detection of orientation features on a material web.
US08476609B2
An EUV light source of the present invention is capable of using a saturable absorber stably and continuously in a high heat load state. A saturable absorber (SA) device is disposed on a laser beam line to absorb feeble light, such as self-excited oscillation light, parasitic oscillation light or return light. SA gas from an SA gas cylinder and buffer gas from a buffer gas cylinder are mixed to be a mixed gas. The mixed gas is supplied to an SA gas cell via a supply pipeline, and absorbs the feeble light included in the laser beam. The mixed gas is exhausted via an exhaust pipeline, and is sent to a heat exchanger. The mixed gas, cooled down by a heat exchanger, is sent back to the SA gas cell by a circulation pump.
US08476608B2
The present invention provides an adjustable aperture for limiting the dimension of a beam of energy. In an exemplary embodiment, the aperture includes (1) at least one piezoelectric bender, where a fixed end of the bender is attached to a common support structure via a first attachment and where a movable end of the bender is movable in response to an actuating voltage applied to the bender and (2) at least one blade attached to the movable end of the bender via a second attachment such that the blade is capable of impinging upon the beam. In an exemplary embodiment, the beam of energy is electromagnetic radiation. In an exemplary embodiment, the beam of energy is X-rays.
US08476601B1
Systems and methods are provided for identifying an atomic element in proximity to an integrated circuit. Trace amounts of a contaminant are identifiable. The atomic element is exposed to neutron radiation to convert a portion of the atomic element into a radioactive isotope of the atomic element. Upsets are measured for the binary states of the memory cells of the integrated circuit during a time period following the exposure to the neutron radiation. The atomic element is identified from the upsets of the binary states of the memory cells of the integrated circuit.
US08476587B2
A mass spectrometer includes an Electron Impact (“EI”) or a Chemical Ionisation (“CI”) ion source, and the ion source includes a first coating or surface. The first coating or surface is formed of a metallic carbide, a metallic boride, a ceramic or DLC, or an ion-implanted transition metal.
US08476582B2
A radiation intensity measuring apparatus is provided for an encapsulated sealed radioactive source for brachytherapy, which is capable of measuring radiation intensity of sources with a cartridge enclosed under sterile conditions. The radiation intensity measuring apparatus includes a radiation intensity measuring device for measuring radiation emitted from a source, a holding device for holding a cartridge, and a moving mechanism for moving the holding device to the radiation intensity measuring device. The moving device includes a guide portion for guiding the movement of the holding device so that the holding device moves along a direction perpendicular to an axial direction of a slit, and a moving portion for moving the holding device so that all the sources loaded in the cartridge pass through a position of the slit in a housing space of a housing portion.
US08476581B2
An apparatus adapted for confocal imaging of a non-flat specimen comprising a coherent light source for producing a light beam, imaging optics adapted to focus the light beam into at least one spot on a surface of a specimen, and a detector adapted to receive and detect light reflected from the specimen surface. The imaging optics comprise at least one optical component located so that the light reflected from the specimen surface passes therethrough on its way to the detector. The optical component is movable so as to move the at least one spot, within a range of movement, to a number of distinct locations in a plane perpendicular to the apparatus' optical axis, within the detector's integration time.
US08476577B2
A miniaturized optical encoder capable of obtaining a sufficient amount of light in the light receiving element is provided. An optical encoder 1 includes a scale 2 having scale markings 21 and a readhead 3 having a light source 31 that emits light to the scale 2, a scale-side lens 32 that transmits the light emitted from the light source 31 to the scale 2, and a light receiving element 33 that receives the light that has been reflected by the scale 2 and that has passed through the scale-side lens 32. The light source 31 is arranged between the scale-side lens 32 and the light receiving element 33, and a distance between the light source 31 and the scale-side lens 32 is set to be a focal distance fs of the scale-side lens 32. An optical axis Lsrc of the light source 31 is matched with an optical axis Ls of the scale-side lens 32 in a reading direction of the scale markings 21 and is separated from an optical axis Ls of the scale-side lens 32 by a predetermined distance D in a direction perpendicular to the reading direction of the scale markings 21.
US08476574B1
A method for improving the analysis of spectral data wherein light is directed through a linearly variable bandpass filter to impinge on a linear array of photodetectors. The ratio of the passband captured by a target detector to the passband captured by adjacent detectors is determined and used to calculate the amount of light to add back to the amount reported by the target detector. The value of the stored information from each target detector is then adjusted by subtracting from that detector what was added to adjacent detectors.
US08476573B2
According to one embodiment, a solid-state imaging device with a plurality of light-receiving layers for acquiring different color signals stacked one on top of another in the optical direction. Each of the light-receiving layers includes a photoelectric conversion part that receives light entering the back side of the layer and generates signal charges and a read transistor that is provided on the front side of the layer and reads the signal charges generated at the photoelectric conversion part. A semiconductor layer is stacked via an insulating film on the front side of the top layer of the plurality of light-receiving layers. At the semiconductor layer, there is provided a signal scanning circuit which processes a signal read by each of the read transistors and outputs a different color signal from each of the light-receiving layers to the outside.
US08476559B2
Tunnel kilns serve for the thermal treatment of products in a continuous operation within a production process. The tunnel kilns are usually made up of a number of identical kiln segments, each segment having a blower, heating elements for heating up the fresh air and a common exhaust air line. For the treatment of the products, they are made to pass by either on the suction side or the pressure side of the blower. To reduce the overall volume of such kilns and to save energy, it is proposed to arrange the blower inside the kiln in such a way that it produces a circulatory flow transversely to the direction of continuous transport and to transport the products to be dried through the circulatory flow parallel to one another in the direction of continuous transport both on the pressure side and on the suction side of the blower. These kilns are preferably used in the production of catalytic converters for automotive exhaust for which a catalyst layer applied to monolithic honeycomb bodies has to be dried and calcined.
US08476557B2
A device for heating a cylindrical component of given diameter is disclosed. The device includes at least two heaters each delivering a stream of hot gas and emerging in an annular chamber. The inside diameter of the annular chamber is slightly greater than the diameter of the cylindrical component. The device may be used for heating a metal journal in which a bearing ring for an inter-shaft bearing in a double-body turbomachine is mounted.
US08476555B2
A welding system is provided that includes a wearable wire feeder having a wire drive motor that is responsive to a control signal received directly from a power unit. Another welding system is provided that includes a wearable wire feeder that is configured to couple to a constant voltage power unit and does not include a voltage sensor. Another welding system is provided that includes a power unit, a wearable wire feeder separate from the power unit, a cable extending directly from the power unit to the wearable wire feeder and a welding torch coupled to and separate from the wire feeder. A method is provided that includes receiving a control signal from a power unit at a wearable wire feeder and driving a welding wire from the wearable wire feeder to a welding torch in response to the control signal, wherein the wearable wire feeder is separate from the torch.
US08476549B2
A method of bonding dissimilar metals, a bonding structure formed by such a method and a bonding apparatus for performing such a method. The resulting bond is capable of preventing corrosion (e.g., electric corrosion) resulting from contact of the dissimilar metals and obtains a dissimilar material joint exhibiting anti-corrosive property and bonding strength at low costs. The method includes overlapping two materials made from dissimilar metals having a seal material interposed therebetween and discharging the seal material from a bonding interface and bonding the two materials in direct contact with each other.
US08476544B2
A device for adjusting an electric parameter, including at least a base having at least two terminal pairs, a positioning body, and at least one first portion. Both ends of at least one of the terminal pair are connected to the first portion. A pair of signal terminals is disposed on the positioning body, and both ends of one of the terminal pairs are contacted with the signal terminal on the positioning body as a position of the base is changed, whereby facilitating adjustment of electric parameters. The device of the invention can be applied to various electronic circuits, RF circuits, microwave circuits, and so on, thus implementing step and quantitative adjustment of the electric parameters.
US08476540B2
A shelter for protecting a portable electrical inlet/outlet (PEIO) includes a base and a cover. In some examples, the base includes a platform to support a body of the PEIO, and the platform is configured to segregate the PEIO body from water that may accumulate. In some examples, the cover configured to mate with the base to substantially enclose the platform. Upon being inserted into the shelter, the PEIO may be protected from unwanted elements, such as rain, snow, unintended contact by humans or animals, or the like.
US08476530B2
A contiguous deep trench includes a first trench portion having a constant width between a pair of first parallel sidewalls, second and third trench portions each having a greater width than the first trench portion and laterally connected to the first trench portion. A non-conformal deposition process is employed to form a conductive layer that has a tapered geometry within the contiguous deep trench portion such that the conductive layer is not present on bottom surfaces of the contiguous deep trench. A gap fill layer is formed to plug the space in the first trench portion. The conductive layer is patterned into two conductive plates each having a tapered vertical portion within the first trench portion. After removing remaining portions of the gap fill layer, a device is formed that has a small separation distance between the tapered vertical portions of the conductive plates.
US08476528B2
A method of fabricating a structure comprising the steps of: providing an electrical conductor; providing a layer of a flexible insulating material on the electrical conductor, the material comprising: a first organo-alkoxide 1RxSi(O1R′)4-x and a second organo-alkoxide 2RxSi(O2R′)4-x, where 1R is a non-hydrolysable organic moiety thermally stable to a temperature of at least 150° C., 2R is a non-hydrolysable organic moiety containing a functional group that can react with another like functional group to form an organic polymer, 1R′ and 2R′ are alkyl radicals and x is an integer from 0 to 3; and an inorganic filler material.
US08476526B2
A device for controlling an electric field at a high voltage component including a resistive layer for field control, an insulating layer arranged on the resistive layer and a semi-conducting or conducting layer arranged on the insulating layer. The three layers meet at a triple point where the insulating layer ends. An interface between the resistive layer and the insulating layer makes in the triple point an angle to the semi-conducting or conducting layer of 60°-120°.
US08476522B2
A power panel designed to incorporate a means of both thermal energy production and electrical energy production from the solar energy produced by the sun. The power panel comprises: a synthetic molded enclosure comprising a solar radiation top surface, bottom surface and sidewalls; and a transparent panel disposed on said synthetic molded enclosure. The transparent panel is adapted to insulate the thermal energy captured by the liquid circulating in the enclosure. The enclosure includes a plurality of segmented partitions adapted to form liquid pathways for channeling a liquid through the enclosure when the transparent panel is disposed on the segmented partitions thereby forming a liquid boundary in proximate contact with the segmented partitions and with the liquid in said enclosure. The power panel can also generate electrical power by incorporating a solar panel disposed between the enclosure and the transparent panel, wherein the solar panel forms a liquid boundary for the liquid circulating in the synthetic enclosure.
US08476519B2
Embodiments are directed to a novel technique used to create electronic apparel that is powered by batteries and generates light, or sound in reaction to various sensors on the garment. The wearer through the use of various options or effects can further modify the output through the use of various options or effects. The electronic apparel includes an image of an instrument and a keypad that allows for user control of sounds generated by electronic circuits incorporated in the garment. Sound generation circuitry and speakers are coupled to the keypad in an electronic assembly that is detachably coupled to the garment in such a way as to allow regular washing of the garment without any damage to the electronic devices.
US08476517B2
Variable timing reference methods of separating and mixing audio tracks from original, musical works
The teachings described herein are generally directed to a system, method, and apparatus for separating and mixing tracks within music. The system can have components that include a processor, an input device, a database, a transformation module, an emulation recording module, an integration engine, an output module, and an output device, wherein each component is operable in itself to perform it's function in the system and operable with other system components to provide a system to a listener of music.
US08476513B2
A key cup adjustment device for a wind instrument has a hinge rod and a key cup assembly. The key cup assembly is mounted on the hinge rod and has at least one solid arm, a key cup, at least one adjusting arm and at least one abutting unit. The at least one solid arm is mounted securely between the hinge rod and the key cup. The at least one adjusting arm is mounted securely on the at least one solid arm and corresponds to the key cup. The at least one abutting unit is connected to the at least one adjusting arm and can be adjusted to abut the key cup. Therefore, the key cup can close a corresponding tone hole tightly and pitches produced by wind instruments are accurate.
US08476512B1
According to some embodiments, a musical instrument comprises a neck, a pickup socket, and a bar coupled between the neck and the pickup socket.
US08476511B1
A system and method to secure a piano fallboard is provided. In one embodiment, a method of retaining the piano fallboard in the upright position includes securing the fallboard to the back panel with a fallboard retaining device. In another embodiment, a method of retaining the piano fallboard in the closed position includes securing the fallboard to the keyslip with the fallboard retaining device. The fallboard retaining device can be a clamping structure or a magnetic device.
US08476510B2
The present invention generally relates to compositions comprising and methods for forming functionalized carbon-based nanostructures.
US08476509B1
The invention provides seed and plants of the hybrid corn variety designated 980010. The invention thus relates to the plants, seeds and tissue cultures of the variety 980010, and to methods for producing a corn plant produced by crossing a corn plant of variety 980010 with itself or with another corn plant, such as a plant of another variety. The invention further relates to genetic complements of plants of variety 980010.
US08476503B1
A novel maize variety designated PH179D and seed, plants and plant parts thereof. Methods for producing a maize plant that comprise crossing maize variety PH179D with another maize plant. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PH179D through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. Hybrid maize seed, plant or plant part produced by crossing the variety PH179D or a locus conversion of PH179D with another maize variety.
US08476497B2
A lettuce cultivar, designated Camino Verde, is disclosed. The invention relates to the seeds of lettuce cultivar Camino Verde, to the plants of lettuce cultivar Camino Verde and to methods for producing a lettuce plant by crossing the cultivar Camino Verde with itself or another lettuce cultivar. The invention further relates to methods for producing a lettuce plant containing in its genetic material one or more transgenes and to the transgenic lettuce plants and plant parts produced by those methods. This invention also relates to lettuce cultivars or breeding cultivars and plant parts derived from lettuce cultivar Camino Verde, to methods for producing other lettuce cultivars, lines or plant parts derived from lettuce cultivar Camino Verde and to the lettuce plants, varieties, and their parts derived from the use of those methods. The invention further relates to hybrid lettuce seeds, plants, and plant parts produced by crossing cultivar Camino Verde with another lettuce cultivar.
US08476491B2
The invention relates to a method of utilizing the pts gene and RNA interference of the ads gene to increase patchouli alcohol content in Artemisia annua L. plants. Using transgenic Artemisia annua L. plants, the method of the invention consistently increases the patchouli alcohol content in those plants, thus laying down a solid foundation for large-scale production of patchouli alcohol and other secondary metabolites such as terpenes other than artemisinin.
US08476490B2
To provide a method for changing the flower color of a moth orchid, particularly a method for producing a moth orchid having a red or reddish flower color from a white moth orchid.A method for producing a moth orchid having a modified flower color, which comprises transfecting a moth orchid with a gene encoding a flavanone 3-hydroxylase, a gene encoding a flavonoid 3′-hydroxylase, a gene encoding a dihydroflavonol 4-reductase and a gene encoding an anthocyanidin synthase and expressing the genes.
US08476485B2
A non-human animal model for amyotrophic lateral sclerosis (ALS) is disclosed. The animal model comprises a rodent whose spinal cord motor neurons have a loss of TAR-DNA binding protein-43 (TDP-43) function and phenotypes exhibit ALS-like symptoms. A method for identifying a candidate agent for treating, preventing and/or inhibiting ALS associated with a loss-of-function of TDP-43 is also disclosed.
US08476479B2
In processing of biomass by catalytic cracking in a fluidized catalytic cracker having a reaction zone, a separation zone, a stripping zone, and a regeneration zone, the feedstock oil containing the biomass is processed in the reaction zone using a catalyst containing 10 to 50 mass % of ultrastable Y-type zeolite under the conditions: outlet temperature of the reaction zone 580 to 680° C., catalyst/oil ratio 10 to 40 wt/wt, reaction pressure 1 to 3 kg/cm2 G, and contact time of the feedstock oil with the catalyst in the reaction zone 0.1 to 1.0 sec, and the catalyst is then treated in the regeneration zone under the conditions: regeneration zone temperature 640 to 720° C., regeneration zone pressure 1 to 3 kg/cm2 G, and exhaust gas oxygen concentration at the regeneration zone outlet 0 to 3 mol %.
US08476475B2
A premix is described for producing an absorption medium for removing acid gases from fluid streams. The premix comprises at least one alkanolamine, piperazine and water, the premix having a total amine content of more than 65% by weight, the molar ratio of water to piperazine in the premix being 1.6 to 4.8. The premix is characterized by a low solidification point. It is diluted with water and/or alkanolamine to give the ready-to-use absorption medium.
US08476472B2
The present invention provides a cooling component or sensate component which has further strong cooling intensity and is excellent in the persistency or refresh-feeling and cool-feeling, a sensate composition comprising the same, and various products comprising the sensate composition. The present invention relates to, as a cooling component or sensate component, (3R)-1-menthyl 3-hydroxybutyrate represented by the following formula (I):
US08476470B2
The present invention herein provides a process for production of a bicyclo[2.2.2]octylamine derivative which may be used as an intermediate for preparation of medical and pharmaceutical products. The process is quite efficient and can produce the derivative in a large-scale while using mild reaction conditions.The process for producing a bicyclo[2.2.2]octylamine derivative comprises the steps of subjecting, to ring-formation, a compound represented by the following general formula (1): [wherein R1 represents an alkyl group having 1 to 6 carbon atoms, which may have a substituent; an arylmethyl group which may have a substituent; or an arylethyl group which may have a substituent], and a compound represented by the following general formula (2): R2—NH2 (2) [wherein R2 represents an alkyl group having 1 to 6 carbon atoms, which may have a substituent; an aralkyl group which may have a substituent; a hydroxyl group; an alkyloxy group having 1 to 6 carbon atoms, which may have a substituent; or an aralkyloxy group which may have a substituent], and then reducing the resulting product.
US08476469B2
A process of producing C1-C4 alkyl nitrite, comprising the following steps: a) firstly feeding nitrogen oxide and oxygen into Reactor I, contacting with an aluminosilicate catalyst, and reacting to produce an effluent I containing NO2 and unreacted NO; b) feeding the effluent I and C1-C4 alkanol into Reactor II, and reacting to produce an effluent II containing C1-C4 alkyl nitrite; and c) separating the effluent II containing C1-C4 alkyl nitrite to obtain C1-C4 alkyl nitrite; wherein reactor I is a fixed bed reactor, and Reactor II is a rotating high-gravity reactor; said nitrogen oxide in step a) is NO, or a mixed gas containing NO and one or more of N2O3 and NO2, wherein the molar number of NO is greater than that of NO2, if any; and the molar ratio of NO in nitrogen oxide to oxygen is 4-25:1.
US08476460B2
Disclosed is a process for preparing a molybdated succinimide complex, the process comprising: (a) reacting an alkyl or alkenyl succinimide of a polyamine of formula I or formula II or mixtures thereof: wherein R is an about C12 to C30 alkyl or alkenyl group, R′ is a straight or branched-chain alkylene group having 2 to 3 carbon atoms, x is 1 to 11, and y is 1 to 10, with an α,β-unsaturated mono-carboxylic acid or carboxylic acid ester, in a charge mole ratio of the α,β-unsaturated mono-carboxylic acid or carboxylic acid ester to the succinimide of formula I or formula II or mixtures thereof of about 0.1:1 to about 6:1, and wherein the reaction temperature is no greater than about 135° C.; and (b) reacting the succinimide product of step (a) with an acidic molybdenum compound to provide the molybdated succinimide complex, wherein the molybdated succinimide complex prepared is a liquid at room temperature.
US08476456B2
Process for the preparation of 4-(imidazol-1-yl)benzenesulfonamide derivatives of formula I, wherein R1 represents optionally substituted aryl or heteroaryl, which comprises treating a compound of formula II, wherein R1 has the same meaning defined in the formula I and But represents tert-butyl, with an acid. The 4-(imidazol-1-yl)benzenesulfonamide derivatives of formula I are useful as anti-inflammatory agents.
US08476448B2
The present invention relates to a novel solid form of 4-[[(6-chloropyridin-3-yl)methyl](2,2-difluoroethyl)amino]furan-2(5H)-one, to processes for its preparation and to its use in agrochemical preparations.
US08476443B2
The present invention provides dyes and labeled reagents that may be used in the detection or quantification of desirable target molecules, such as proteins, nucleic acids and cellular organelles. Dyes are provided that may be used free in solution where the binding of the dye to the target molecule provides signal generation. Dyes provided in this invention can comprise reactive groups that may be used to attach the dyes to probes that will bind to desirable target molecules. The novel dyes of the present invention have been substituted with specific groups to provide beneficial properties.
US08476442B2
The invention provides a process for the preparation of a compound of Formula 1, comprising coupling a carboxylic acid of Formula 2 with an aniline of Formula 3 in the presence of a coupling agent.
US08476441B2
(S)-(+)-3-(aminomethyl)-5-methyl-hexanoic acid or (S)-pregabalin is an anticonvulsive drug. In addition to its use as an anticonvulsive agent, pregabalin has also been indicated as a medicament in the treatment of anxiety, neuropathic pain and pain in patients with fibromyalgia. Provided herein are thioester intermediates in the synthesis of and processes for the synthesis of 3-(aminomethyl)-5-methyl-hexanoic acid in the (R) or (S) configuration.
US08476431B2
The present invention provides chemical entities, compounds and pharmaceutical compositions thereof that are capable of modulating certain protein kinases such as mTor, tyrosine kinases, and/or lipid kinases such as PI3 kinase. For example, the invention provides compounds of Formula: Also provided in the present invention are methods of making such compounds or compositions, and methods of using these compositions to modulate activities of one or more of these kinases, especially for therapeutic applications such as treatment of cancer.
US08476430B2
Compounds having the formula (I), and enantiomers, and diastereomers, pharmaceutically-acceptable salts, thereof, are useful as kinase modulators, including Btk modulation, wherein R1, R2, R3, R4, Q, A and B are as defined herein.
US08476429B2
An intermediate for production of a quinolone synthetic antibacterial agent and a therapeutic agent for an infection which exhibit broad spectrum and strong antibacterial activity for both Gram positive and Gram negative bacteria.
US08476428B2
A method of preparing a cyclic monomer, comprising: forming a first mixture comprising a precursor compound, bis(pentafluorophenyl)carbonate, and a catalyst; wherein the precursor compound has a structure comprising a) two or more carbons, and b) two functional groups selected from the group consisting of primary amine, secondary amine, thiol group, hydroxyl group, and combinations thereof; and agitating the first mixture at a temperature effective to form a second mixture comprising the cyclic monomer, the cyclic monomer selected from the group consisting of a cyclic carbonate, a cyclic carbamate, a cyclic urea, a cyclic thiocarbonate, a cyclic thiocarbamate, and a cyclic dithiocarbonate.
US08476427B2
Provided herein are processes for the production of methionine or selenomethionine from homoserine. In particular, the processes proceed via the production of carbamate intermediates.
US08476424B2
A method of removing a carboxylic acid from a liquid that contains a tertiary amide solvent includes a step of contacting the liquid with an extraction medium comprising an amine. The amine is immiscible with both water and the tertiary amide solvent, and the contacting step forms a de-acidified phase containing the tertiary amide solvent and a phase containing the extraction medium and the carboxylic acid. Both the liquid that contains the tertiary amide solvent and the de-acidified phase may also contain a sucrose-6-acylate.
US08476418B2
The present invention is concerned with the provision of a polynucleotide encoding an AAV capsid polypeptide comprising an inserted peptide and a vector comprising said polynucleotide. Moreover, contemplated is a host cell comprising said polynucleotide or vector, a method for the manufacture of said capsid polypeptide as well as said polypeptide. Further included is an antibody specifically binding to said polypeptide and a medicament comprising said polynucleotide, vector, polypeptide, or antibody. Also contemplated are the use of said polynucleotide, vector, polypeptide, or antibody for the manufacture of a medicament for the treatment of vascular disease and a method for the identification of a compound binding to said polypeptide.
US08476414B2
An inventive substrate is provided which includes a substrate compound of formula A—B1—B2—B3: wherein A is a sugar moiety; B1 is a linker moiety allowing the conjugation of moiety A and the remaining structure of the substrate; B2 contains a permanently charged element such as a quaternary ammonium group so as to increase proton affinities and ionization efficiencies for mass spectrometry detection efficiencies analysis; and B3 of various carbon length conferring specificities to targeted enzymes. Also provided is a process to detect lysosomal diseases by contacting a sample with the inventive substrate along with an internal standard which is isotope-labeled analog of the product cleaved by a targeted enzyme upon the substrate.
US08476410B2
Disclosed herein are isolated human monoclonal antibodies, and functional fragments thereof, that specifically bind HMW-MAA. Nucleic acids encoding these antibodies, expression vectors including these nucleic acid molecules, and isolated host cells that express the nucleic acid molecules are also disclosed. The antibodies can be used to detect HMW-MAA in a sample. Methods of diagnosing cancer, or confirming a diagnosis of cancer, are disclosed herein that utilize these antibodies. Methods of treating a subject with cancer are also disclosed.
US08476406B2
The invention relates to polypeptides comprising an N-terminal portion and a C-terminal portion, wherein said N-terminal portion comprises the signature sequence QGP[P or L] and the amino acid sequence of said C-terminal portion is at least 70% identical to SEQ ID NO: 1, and uses thereof.
US08476405B2
The present invention provides polypeptide variants of neuregulin-1β (NRG-1β) that have enhanced or decreased binding affinity to ErbB3 and/or ErbB4. The invention also provides methods of screening and producing polypeptide variants of NRG-1β and methods of using polypeptide variants of NRG-1β for treating diseases.
US08476401B2
A resist polymer (Y′), which is used as a resist resin in DUV excimer laser lithography, electron beam lithography, and the like, contains a polymer (Y) comprising: a constituent unit (A) having a lactone skeleton; a constituent unit (B) having an acid-eliminable group; a constituent unit (C) having a hydrophilic group; and a constituent unit (E) having a structure represented by the following formula (1), wherein a content of the constituent unit (E) is 0.3 mol % or more based on the total number of the constituent units of the resist polymer (Y′): in the formula (1), L is a divalent linear, branched, or cyclic C1-20 hydrocarbon group which may have a substituent and/or a heteroatom; R11 is a g-valent linear, branched, or cyclic C1-20 hydrocarbon group which may have a substituent and/or a heteroatom; and g represents an integer of 1 to 24.
US08476395B2
The present invention relates to a polypropylene composition comprising a propylene homopolymer or a propylene random copolymer having at least one comonomer selected from alpha-olefins with 2 or 4-8 carbon atoms and a comonomer content of not more than 8.0 wt %, wherein the propylene homo- or copolymer is polymerized in the presence of a Ziegler-Natta catalyst, and the polypropylene composition has a MWD of 2.0 to 6.0 and an MFR (2.16 kg/230° C.) of 4.0 g/10 min to 20.0 g/10 min, characterized in that the polypropylene composition has not been subjected to a vis-breaking step, the use of the inventive polypropylene composition for the production of a film and/or injection molded articles, a process for preparing a film wherein the inventive polypropylene composition is formed into a film, and wherein the polypropylene composition has not been subjected to a vis-breaking step and a film comprising the inventive polypropylene composition.
US08476392B2
A process for the production of an ethylene alpha-olefin copolymer is disclosed, the process including polymerizing ethylene and at least one alpha-olefin by contacting the ethylene and the at least one alpha-olefin with a metallocene catalyst in at least one gas phase reactor at a reactor pressure of from 0.7 to 70 bar and a reactor temperature of from 20° C. to 150° C. to form an ethylene alpha-olefin copolymer. The resulting ethylene alpha-olefin copolymer may have a density D of 0.927 g/cc or less, a melt index (I2) of from 0.1 to 100 dg/min, a MWD of from 1.5 to 5.0. The resulting ethylene alpha-olefin copolymer may also have a peak melting temperature Tmax second melt satisfying the following relation: Tmax second melt>D*398−245.
US08476389B2
The present invention provides transparent silicone hydrogels with high acrylamide monomer content and an excellent balance between moisture content.The silicone hydrogels may be obtained by polymerizing a monomer mix containing a plurality of monomers, wherein the monomer mix comprises about 30 to about 98% by weight of at least one type of silicone monomer which is, and about 1 to about 50% by weight of at least one type of non-silicone type (meth)acrylamide monomer containing two or more hydroxyl groups within a molecule; wherein the weight percents are based upon the total amount of monomer components and polymer components in the monomer mix.
US08476386B2
The present invention provides a branched, a dendritic, or a hyperbranched poly(amino ester) having a polymer backbone comprising a plurality of branches, wherein the polymer backbone has at least one secondary and at least one tertiary amine linkage. Branched poly(amino ester)s are prepared via a Michael addition reaction of a tris(acrylate ester)monomer with a diamine monomer. In one aspect, the diamine monomer has a primary amino group and a secondary amino group. The poly(amino ester) compounds can be end-capped by reacting with a suitable agent. The present invention also provides applications including, but are not limited to, the delivery of bioactive agents, such as drugs, DNA or RNA; or biocompatible imaging.
US08476375B2
The invention relates to a process for grafting hydrolysable silane groups to a polyolefin, comprising reacting the polyolefin with an unsaturated silane, containing an olefinic —C═C— bond or acetylenic —C≡C— bond and having at least one hydrolysable group bonded to Si, or a hydrolysate thereof, in the presence of means capable of generating free radical sites in the polymer. The silane contains an aromatic ring or a further olefinic double bond or acetylenic unsaturation, the aromatic ring or the further olefinic double bond or acetylenic unsaturation being conjugated with the olefinic —C═C— or acetylenic —C≡C— unsaturation of the silane. The unsaturated silane may also contains electron-withdrawing moiety with respect to the olefinic —C═C— or acetylenic —C≡C— bond. The invention permits to provide a silane-modified polyolefin having a high grafting efficiency while limiting/preventing polymer degradation by chain scission. The silane-modified polyolefin can be further reacted with a polar surface, a filler or a polar polymer or reacted on itself to crosslink the polyolefin and obtain enhanced physical properties of the composites made thereof.
US08476374B2
The present invention relates to an activated silane compound obtained by reacting a hydrocarbyloxysilane compound with an organic metal compound in an organic solvent, and enhancing interaction of silica with carbon black and improving the fracture characteristic, the abrasion resistance and the low heating property provide an activated silane compound which can be reduced in a blending amount, a rubber composition prepared by blending it as a silane coupling agent and a pneumatic tire prepared by using the above rubber composition, which is excellent in a durability, a low heating property and the like.
US08476362B2
The invention relates to moisture-curing polyisocyanate mixtures, to a process for their preparation and to their use as binders in lacquers, coatings, adhesives and sealing materials.
US08476360B2
This invention relates to a film or sheet and a process to make a film or sheet having a thickness of 0.5 to 35 mils comprising a blend composition comprising: a) 4 to 50 wt % of one or more polypropylene-based TPO(s); and b) 30 to 80 wt % of one or more ethylene plastomer(s); and c) 0.5 to 35 wt % of one or more non-functionalized plasticizer(s) having a kinematic viscosity at 100° C. of 4 to 300 cSt, a pour point of −20° C. or less, and a flash point of 200° C. or more; and d) 0 to 69.5 wt % of one or more filler(s); and wherein the blend composition is calendered into a film or sheet.
US08476357B2
A method for making a composite carbon nanotube structure includes the following steps. An organic solvent, a polymer, and a carbon nanotube structure are provided. The polymer is dissolved in the organic solvent to obtain a polymer solution. The carbon nanotube structure is soaked with the polymer solution. A contact angle between the organic solvent and a carbon nanotube is less than 90 degrees.
US08476355B2
A long glass reinforced resin composite of the present invention may comprise two kinds of thermoplastic matrix resin (a1, a2) which have different viscosities and a long glass fiber (B). The method of preparing the long glass reinforced resin composite comprises preparing a LFT (Long fiber thermoplastic) master-batch composition by impregnating the long glass fiber (B) of continuous phase into the low viscosity thermoplastic resin (a2), and compounding the LFT (Long fiber thermoplastic) master-hatch composition with high viscosity thermoplastic resin. The long glass fiber reinforced resin composite of the present invention has excellent mechanical properties such as impact strength, tensile strength, and flexural modulus.
US08476354B2
The invention relates to resin compositions comprising a) at least one amorphous semi-aromatic polyamide; b) at least two semi-crystalline polyamides, b1) and b2) and c) at least one glass reinforcement agent and shaped articles thereof showing a good balance of properties in terms of good mechanical properties, excellent surface appearance and reduced sink marks.
US08476344B2
A method of producing sulfur modified organosilane compounds that can be used in asphalt binders which method involves: combining together an organosilane or mixtures of organosilanes, a sulfide, a halogen acceptor and solvent to form a reaction mixture; and allowing the organosilane to react with the sulfide in the presence of a halogen acceptor to produce a sulfur modified organosilane compound. The sulfur modified organosilane compound can be introduced into a polymer modified or unmodified asphalt binder in which the sulfur modified organosilane compound reacts with components in the asphalt mixture to form a modified asphalt. The organosilanes used to produce the sulfur modified organosilanes can be from a source of waste products (such as Direct Product Residue) in which case the waste products can be reused in asphalt binders.
US08476339B2
A method and apparatus for producing a composite solid surface article are disclosed. The method includes feeding a first composition toward a mixing point and feeding solid particles toward the mixing point. The method further includes mixing at the mixing point the first composition and the solid particles fed to the mixing point to form a second composition, and transferring the second composition away from the mixing point. The method further comprises polymerizing the polymerizable compound in the second compound so as to form a curable composition comprising the solid particles. The apparatus includes a solid particle feeder, a slurry feeder and a blender configured to blend and transfer a mixture of the solid surface forming slurry and solid particles away from the blending area. The composite solid surface article produced using the method and apparatus contain particles with a size greater than 5 mm.
US08476332B2
A single phase curable composition for use in inkjet printing, comprising at least one cationically curable material, at least one cationic photoinitiator and water together with a method of inkjet printing such compositions is provided.
US08476329B2
A bioresin composition is used to form a rigid polyurethane article that includes a first and a second biopolyol and is substantially free of aprotic solvents that chemically decompose in the presence of water. The first biopolyol includes a natural oil component. The second biopolyol includes the reaction product of a natural carbohydrate and an alkylene oxide. The rigid polyurethane foam article includes the reaction product of the bioresin composition and an isocyanate which are reacted in the presence of a chemical blowing agent.
US08476328B2
A method for manufacturing a polishing pad that has high level of optical detection accuracy and is prevented from causing slurry leak from between the polishing region and the light-transmitting region includes preparing a cell-dispersed urethane composition by a mechanical foaming method; placing a light-transmitting region at a predetermined position on a face material or a belt conveyor, continuously discharging the cell-dispersed urethane composition onto part of the face material or the belt conveyor where the light-transmitting region is not placed; placing another face material or belt conveyor on the discharged cell-dispersed urethane composition; curing the cell-dispersed urethane composition to form a polishing region including a polyurethane foam, so that a polishing sheet is prepared; applying a coating composition containing an aliphatic and/or alicyclic polyisocyanate to one side of the polishing sheet and curing the coating composition to form water-impermeable film; and cutting the polishing sheet.
US08476321B2
The present invention is directed to a catalyst suitable for catalyzing a Fischer-Tropsch reaction, said catalyst comprising cobalt metal supported on zinc-oxide and an amount of zirconium(IV)oxide and/or aluminum oxide of between 0.5 and 2.5 wt. % calculated as metal, based on the weight of the calcined catalyst.
US08476319B2
Methods of treating and/or preventing otitis media in a subject are provided. Methods of treating and/or preventing otitis externa are also provided.
US08476314B2
A substance with sedative effect comprises a therapeutically effective amount of a gamma-pyrone such as comenic acid in a pharmaceutically acceptable carrier. When administered at a daily dosage of between 0.05 mg to about 10,000 mg of active ingredient per unit dose, the substance can be used to treat various disorders of a nervous system such as pain, insomnia, anxiety, neurosis, depression, as well as withdrawal symptoms experienced by drug addiction patients, especially for patients addicted to opiate-based drugs. The substance can be delivered in a number of ways of systemic administration of a pharmaceutical agent including oral, parenteral, transdermal, and transmucosal administration. One disclosed method of administration involves a subcutaneous implant providing a continuous release of an active ingredient at an effective daily rate over the entire treatment period ranging from 5 to 30 days, and preferably from 13 to 20 days.
US08476313B2
Compounds and methods useful for treating and prevention of cancer, particularly hormone-dependent breast cancer. Provided are compounds of formula I: wherein X is selected from O, N, S, SO, SO2, and S(CH2)n, wherein n=1-10; R1 and R2 may be the same or different and are selected from H, OH, OCH3, OCH2CH3, OCH2C6H5, NH2, NHCH3, N(CH3)2, CH3, CH2CH3, CH2CH2CH3, CH(CH3)2, C(CH3)3, NO2, F, Cl, Br, CF3, SH, SCH3, SCH2CH3, OCOCH3, OCOC(CH3)3, OCOCH2COOH, and CN; and R3 is a nitrogen-containing heterocyclic ring. Also provided are method for treating or preventing cancer in a subject by administering a therapeutically effective amount of a heteroaryl-containing isoflavone, or a pharmaceutically acceptable salt or prodrug thereof, to a subject in need of treatment. Also provided is a method for the synthesis of 2-substituted isoflavones by first reacting deoxybenzoins with a phase transfer catalyst to provide a 2-(alkylthio)isoflavone; second deprotecting the 2-(alkylthio)isoflavone; and third applying selective debenzylation to form the final compound.
US08476306B2
The invention relates to novel inhibitors of urokinase and to their preparation and use for the therapy, prophylaxis and diagnosis of a tumor, in particular for reducing the formation of tumor metastases.
US08476300B2
The present invention is directed to a compound of the formula (A): or a pharmaceutically acceptable salt thereof; and also to compounds of formula (I): or a pharmaceutically acceptable salt thereof.
US08476296B2
The present invention relates to compounds that bind to and modulate the activity of neuronal nicotinic acetylcholine receptors, to processes for preparing these compounds, to pharmaceutical compositions containing these compounds, and to methods of using these compounds for treating a wide variety of conditions and disorders, including those associated with dysfunction of the central nervous system (CNS).
US08476295B2
The present invention is directed to synthetic bridged bicyclic compounds that are inhibitors of rho-associated protein kinase. The present invention is also directed to pharmaceutical compositions comprising such compounds and a pharmaceutically acceptable carrier. The invention is additionally directed to a method of preventing or treating diseases or conditions associated with cytoskeletal reorganization. The method comprises administering to a subject a therapeutically effective amount of a Rho kinase inhibitory compound of Formula I, wherein said amount is effective to influence the actomyosin interactions, for example, by leading to cellular relaxation and alterations in cell-substratum adhesions. In one embodiment, the method treats increased intraocular pressure, such as primary open-angle glaucoma. In another embodiment, the method treats diseases or conditions of the lung associated with excessive cell proliferation, remodeling, inflammation, vasoconstriction, bronchoconstriction, airway hyperreactivity and edema.
US08476284B2
Disclosed herein are compounds, including compounds having the Formula (A) where A, R1, R2, R3, and R4 are as defined in the specification, that form covalent bonds with Bruton's tyrosine kinase (Btk). Also described are irreversible inhibitors of Btk. Methods for the preparation of the compounds are disclosed. Also disclosed are pharmaceutical compositions that include the compounds. Methods of using the Btk inhibitors are disclosed, alone or in combination with other therapeutic agents, for the treatment of autoimmune diseases or conditions, heteroimmune diseases or conditions, cancer, including lymphoma, and inflammatory diseases or conditions.
US08476269B2
The present invention provides pyridine and pyrazine derivatives which restore or enhance the function of mutant and/or wild type CFTR to treat cystic fibrosis, primary ciliary dyskinesia, chronic bronchitis, chronic obstructive pulmonary disease, asthma, respiratory tract infections, lung carcinoma, xerostomia and keratoconjunctivitis sire, or constipation (IBS, IBD, opioid induced). Pharmaceutical compositions comprising such derivatives are also encompassed.
US08476266B2
A compound represented by formula (I), wherein R1 represents a hydrogen atom, etc., R2 and R3 each independently represents a hydrogen atom, optionally oxidized C1-4 alkyl group or optionally protected hydroxyl group, or R2 and R3 taken together represent optionally oxidized C2-5 alkylene group, R4 represents an optionally oxidized C1-6 alkyl group, etc., R5 represents an optionally oxidized C1-6 alkyl group, etc., R6 represents an optionally oxidized C1-6 alkyl group, etc., m represents 0 or an integer from 1 to 3, n represents 0 or an integer from 1 to 4, and i represents 0 or an integer from 1 to 7.
US08476264B2
The present invention provides N-(3-(2-amino-6,6-difluoro-4,4a,5,6,7,7a-hexahydro-cyclopenta[e][1,3]oxazin-4-yl)-phenyl)-amides of formula I having BACE1 inhibitory activity, their manufacture, pharmaceutical compositions containing them and their use as therapeutically active substances. The active compounds of the present invention are useful in the therapeutic and/or prophylactic treatment of e.g. Alzheimer's disease.
US08476260B2
The present invention relates to a novel antitumor agent containing a compound that inhibits binding between acetylated histone and a bromodomain-containing protein, preferably a thienotriazolodiazepine compound represented by the following formula (I) wherein each symbol is as defined in the description, or a pharmaceutically acceptable salt thereof or a hydrate or solvate as an active ingredient.
US08476258B2
A novel compound having NMDA receptor channel blocking activity, is provided. A pharmaceutical agent comprising the compound is also provided. The pharmaceutical agent can be used for the treatment or prevention of a disease caused by overexcitation of an NMDA receptor, and can comprise a compound having NMDA receptor channel blocking activity and represented by the formula (1), or a pharmaceutically acceptable salt thereof.
US08476250B2
A method of treatment using a water-soluble cocrystal composition contains a quantity of acetylsalicylic acid and a quantity of a theanine enantiomer selected from an alpha variant of theanine or a beta variant of theanine or other form of theanine.
US08476247B2
Provided herein is a method of reducing intraocular pressure (IOP) in humans using N6-cyclopentyladenosine (CPA), CPA derivatives or prodrugs or enhanced cornea permeability formulations of CPA. In one embodiment, the invention is directed to CPA derivatives or prodrugs that are permeable to the cornea. In another embodiment, the invention is directed to uses of certain compounds in human subjects for reducing and/or controlling elevated or abnormally fluctuating IOPs in the treatment of glaucoma or ocular hypertension (OHT).
US08476243B2
A method for keratin hyperproliferation disorders such as corns, calluses, or keratosis pilaris (KP) by administering to a subject experiencing the disorder a therapeutically effective amount of an RNA sequence which inhibits expression of a gene encoding for a keratin selected from the group consisting of K6a, K6b, K16, K17, and combinations thereof.
US08476230B2
The present invention relates to an insulinotropic peptide conjugate having improved in-vivo duration of efficacy and stability, comprising an insulinotropic peptide, a non-peptide polymer and an immunoglobulin Fc region, which are covalently linked to each other, and a use of the same. The insulinotropic peptide conjugate of the present invention has the in-vivo activity which is maintained relatively high, and has remarkably increased blood half-life, and thus it can be desirably employed in the development of long acting formulations of various peptide drugs.
US08476228B2
The present invention relates to insulin derivatives having a side chain attached either to the α-amino group of the N-terminal amino acid residue of the B chain or to the ε-amino group of a Lys residue present in the B chain of the parent insulin via an amide bond which side chain comprises at least one aromatic group; at least one free carboxylic acid group or a group which is negatively charged at neutral pH, a fatty acid moiety with 4 to 22 carbon atoms in the carbon chain; and possible linkers which link the individual components in the side chain together via amide bonds.
US08476224B2
The present application describes organic compounds that are useful for the treatment, prevention and/or amelioration of diseases.
US08476223B2
Formulations are provided for the improvement of sleep patterns. The formulations generally include a trigger complex, an elemental complex and a coenzyme-vitamin B complex. The trigger complex is high in fiber such as glucomannan and includes Metallo-Lactoferrin protein in an alkaline buffer system. The elemental complex includes one or more trace element as a suitable salt. The coenzyme-vitamin B complex includes one or more coenzyme, coenzyme precursor and/or B-vitamin. The compositions may optionally include additional components such as 5-hydroxy-L-tryptophan (5-HTP), choline, melatonin, milk protein hydrolysate, L-arginine, and L-carnitine. The compositions can be administered orally in a variety of forms.
US08476218B1
Antimicrobial compositions and related methods are described. In an embodiment of the invention, an antimicrobial composition comprises parachlorometaxylenol in an amount of 0.75% w/w to 1% w/w; sodium pareth C12-15 sulfonate in an amount of 1% w/w to 1.25% w/w; poly(oxyethylene)20 cetyl ether in an amount of 0.05% w/w to 0.55% w/w; benzoic acid in an amount of 0.075% w/w to 1.25% w/w; glycerol in an amount of 0.01% w/w to 0.02% w/w; phenoxyethanol in an amount of 0.001% w/w to 0.5% w/w; and water in an amount of 94% w/w to 97% w/w.
US08476212B2
The disclosure relates to novel detergent compositions comprising, in a cosmetically acceptable medium, at least one sulfate or sulfonate anionic surfactant, at least one amphoteric and/or zwitterionic surfactant and at least one particular amino silicone, the (amphoteric and/or zwitterionic surfactant)/(sulfate or sulfonate anionic surfactant) weight ratio ranging from 1:1 to 2:1, the total amount of surfactants representing from 4% to 35% by weight relative to the total weight of the final composition. The disclosure also relates to the use of the composition for protecting the coloration of, for example, artificially dyed hair.
US08476208B2
Disclosed are a water-soluble metal-processing agent and a coolant both of which have excellent microbial deterioration resistance and are less likely to go rotten, a method for preparing the agent or the coolant, and a metal processing method. The water-soluble metal-processing agent or the coolant comprises an N,N,N′,N′-tetraalkyldiamine compound. The metal processing method is characterized by processing a metal of interest by using the water-soluble metal-processing agent or the coolant.
US08476204B2
A Lubricant comprises a carboxylic-acid-amide which is based on aliphatic unbranched, alicyclic and/or aromatic chains with chain length from 2 to 60 carbon atoms.
US08476198B2
A treatment of N-(phenylethyl)succinamic acid or its salts provides enhancement of fungicide activity of a fungicide azole compound, and thus, a fungicidal composition comprising a fungicide azole compound and N-(phenylethyl)succinamic acid or its salts is effective for controlling plant diseases and may also enhance plant growth.
US08476196B2
The subject invention pertains to compositions, apparatus, and methods for controlling harmful algae and harmful algal bloom (HAB) based on the induction of the programmed cell death (PCD; apoptosis) pathway in the harmful algae, and to kits for determining algal susceptibility to PCD induction.
US08476185B2
Disclosed are an apparatus and method for preparing a manganese oxide-titania catalyst. The apparatus for preparing a manganese oxide-titania catalyst includes: a vaporizer vaporizing a manganese precursor and a titanium precursor; a carrier gas supply line supplying a carrier gas, which carries precursor vapors vaporized by the vaporizer to a reactor, to the vaporizer; an oxygen supply line supplying an oxygen source to the reactor; the reactor reacting the precursor vapors with the oxygen source to synthesize a manganese oxide-titania catalyst; and a collector condensing and collecting the manganese oxide-titania catalyst synthesized in the reactor. And, the method for preparing a manganese oxide-titania catalyst includes: 1) vaporizing a manganese precursor and a titanium precursor; 2) carrying precursor vapors (vapors of the manganese precursor and the titanium precursor) and an oxygen source to a reactor; 3) reacting the precursor vapors and the oxygen source to synthesize a manganese oxide-titania catalyst; and 4) condensing and collecting the manganese oxide-titania catalyst. According to the present disclosure, mass production of manganese oxide-titania catalysts with high decomposition efficiency of organic compounds can be prepared through fewer and continuous processes.
US08476184B2
The invention relates to a bulk catalyst composition comprising metal oxidic particles comprising one or more Group VIII metals and two or more Group VIB metals, which bulk catalyst composition comprises first metal oxidic particles comprising one or more first Group VIII metals and one or more first Group VIB metals and separately prepared second metal oxidic particles comprising one or more second Group VIII metals and one or more second Group VIB metals, wherein the composition of Group VIB and Group VIII metals in the first and second metal oxidic particles are different, wherein the first and second oxidic bulk particles-are separately shaped to separate first and second shaped bulk catalyst particles, which are combined, preferably into a homogeneous blend, to form the bulk catalyst composition. The invention further relates to a process for the preparation of the bulk catalyst composition and to hydroprocessing a hydrocarbon feed using the bulk catalyst composition.
US08476183B2
The invention provides: a polycondensation catalyst for polyester production, which contains titanium atoms, alkaline earth metal atoms and phosphorus atoms, has high reactivity and excellent long-term storage stability, can be easily produced industrially, and has an advantage in cost; a polyester resin obtained with the catalyst; and a molded article. These are: a polymerization catalyst for polyester production containing titanium atoms, alkaline earth metal atoms and phosphorus atoms and having a specific constitution; a polyester resin obtained with the catalyst; and a molded article.
US08476178B2
An optical glass comprising, by mass %, 12 to 40% of SiO2, 15% or more but less than 42% of Nb2O5, 2% or more but less than 18% of TiO2, (provided that Nb2O5/TiO2 is over 0.6), 0.1 to 20% of Li2O, 0.1 to 15% of Na2O, and 0.1 to 25% of K2O, and having an Abbe's number νd of 20 to 30, a ΔPg,F of 0.016 or less and a liquidus temperature of 1,200° C. or lower.
US08476175B2
The invention relates to glass strands especially for the production of composites having an organic and/or inorganic matrix, the composition of which strands comprises the following constituents in the limits defined below, expressed as percentages by weight: SiO250-65% Al2O312-23% SiO2 + Al2O3 >79% CaO 1-10% MgO 6-12% Li2O 1-3%, preferably 1-2% BaO + SrO 0-3% B2O3 0-3% TiO2 0-3% Na2O + K2O <2% F2 0-1% Fe2O3 <1%. These strands are made of a glass offering an excellent compromise between its mechanical properties, represented by the specific Young's modulus, and its melting and fiberizing conditions.
US08476169B2
A method for fabricating a strained channel semiconductor structure includes providing a substrate, forming at least one gate structure on said substrate, performing an etching process to form two recesses in said substrate at opposites sides of said gate structure, the sidewall of said recess being concaved in the direction to said gate structure and forming an included angle with respect to horizontal plane, and performing a pre-bake process to modify the recess such that said included angle between the sidewall of said recess and the horizontal plane is increased.
US08476166B2
A manufacturing method of a semiconductor device includes: forming step of forming an etching mask on a second main face of a substrate, the etching mask being made of Cu or Cu alloy and having an opening, the second main face being on an opposite side of a first main face of the substrate where a nitride semiconductor layer is provided; a first etching step of applying a dry etching to the second main face of the substrate with use of the etching mask so that all of or a part of the nitride semiconductor layer is left; a removing step of removing the etching mask after the first etching step; and a second etching step of dry-etching the left nitride semiconductor layer after the removing step.
US08476161B2
Provided is a Cu electrical interconnection film forming method, wherein an adhesive layer (base film) having improved adhesiveness with a Cu electrical interconnection film is used, in a semiconductor device manufacturing process. After forming a barrier film on a substrate whereupon a hole or the like is formed, a PVD-Co film or a CVD-Co film or an ALD-Co film is formed on the barrier film. Then, after filling up or burying the hole or the like, which has the Co film formed on the surface, with a CVD-Cu film or a PVD-Cu film, heat treatment is performed at a temperature of 350° C. or below, and the Cu electrical interconnection film is formed.
US08476160B2
A first low dielectric constant (low-k) dielectric material layer is lithographically patterned to form a recessed region having expose substantially vertical sidewalls, which are subsequently damaged to de-carbonize a surface portion at the sidewalls having a sublithographic width. A second low-k dielectric material layer is deposited to fill the recessed region and planarized to exposed top surfaces of the damaged low-k dielectric material portion. The damaged low-k dielectric material portion is removed selective to the first and second low-k dielectric material layers to form a trench with a sublithographic width. A portion of the pattern of the sublithographic-width trench is transferred into a metallic layer and optionally to an underlying dielectric masking material layer to define a trench with a sublithographic width, which can be employed as a template to confine the widths of via holes and line trenches to be subsequently formed in an interconnect-level dielectric material layer.
US08476159B2
A substrate structure with compliant bump comprises a substrate, a plurality of bumps, and a metallic layer, wherein the substrate comprises a surface, a trace layer, and a protective layer. The trace layer comprises a plurality of conductive pads, and each of the conductive pads comprises an upper surface. The protective layer comprises a plurality of openings. The bumps are formed on the surface, and each of the bumps comprises a top surface, an inner surface and an outer surface and defines a first body and a second body. The first body is located on the surface. The second body is located on top of the first body. The metallic layer is formed on the top surface, the inner surface, and the upper surface.
US08476154B2
The present invention provides a charge trapping non-volatile semiconductor memory device and a method of making the device. The charge trapping non-volatile semiconductor memory device comprises a semiconductor substrate, a source region, a drain region, and, consecutively formed over the semiconductor substrate, a channel insulation layer, a charge trapping layer, a blocking insulation layer, and a gate electrode. The drain region includes a P-N junction, and the source region includes a metal-semiconductor junction formed between the semiconductor substrate and a metal including titanium, cobalt, nickel, platinum or one of their various combinations. The charge trapping non-volatile semiconductor memory device according to the present disclosure has low programming voltage, fast programming speed, low energy consumption, and relatively high device reliability.
US08476151B2
According to one embodiment, a method is disclosed for manufacturing a nitride semiconductor crystal layer. The method can include forming the nitride semiconductor crystal layer having a first thickness on a silicon crystal layer. The silicon crystal layer is provided on a base body. The silicon crystal layer has a second thickness before the forming the nitride semiconductor crystal layer. The second thickness is thinner than the first thickness. The forming the nitride semiconductor crystal layer includes making at least a portion of the silicon crystal layer incorporated into the nitride semiconductor crystal layer to reduce a thickness of the silicon crystal layer from the second thickness.
US08476150B2
A method and structure for a semiconductor device, the device including a handle wafer, a diamond layer formed directly on a front side of the handle wafer, and a thick oxide layer formed directly on a back side of the handle wafer, the oxide of a thickness to counteract tensile stresses of the diamond layer. Nitride layers are formed on the outer surfaces of the diamond layer and thick oxide layer and a polysilicon is formed on outer surfaces of the nitride layers. A device wafer is bonded to the handle wafer to form the semiconductor device.
US08476149B2
A silicon wafer produced from a silicon single crystal ingot grown by Czochralski process is subjected to rapid heating/cooling thermal process at a maximum temperature (T1) of 1300° C. or more, but less than 1380° C. in an oxidizing gas atmosphere having an oxygen partial pressure of 20% or more, but less than 100%. The silicon wafer according to the invention has, in a defect-free region (DZ layer) including at least a device active region of the silicon wafer, a high oxygen concentration region having a concentration of oxygen solid solution of 0.7×1018 atoms/cm3 or more and at the same time, the defect-free region contains interstitial silicon in supersaturated state.
US08476148B2
The invention relates to a method for transferring a layer from a donor substrate onto a handle substrate wherein, after detachment, the remainder of the donor substrate is reused. To get rid of undesired protruding edge regions which are due to the chamfered geometry of the substrates, the invention proposes to carry out an additional etching process before detachment occurs.
US08476146B2
Provided is a method of fabricating a semiconductor device. The method includes forming a first layer on a first side of a first silicon wafer. The first silicon wafer has a second side opposite the first side. The first layer has a coefficient-of-thermal-expansion (CTE) that is lower than that of silicon. The method includes bonding the first wafer to a second silicon wafer in a manner so that the first layer is disposed in between the first and second silicon wafers. The method includes removing a portion of the first silicon wafer from the second side. The method includes forming a second layer over the second side of the first silicon wafer. The second layer has a CTE higher than that of silicon.
US08476144B2
An arrangement, process and mask for implementing single-scan continuous motion sequential lateral solidification of a thin film provided on a sample such that artifacts formed at the edges of the beamlets irradiating the thin film are significantly reduced. According to this invention, the edge areas of the previously irradiated and resolidified areas which likely have artifacts provided therein are overlapped by the subsequent beamlets. In this manner, the edge areas of the previously resolidified irradiated areas and artifacts therein are completely melted throughout their thickness. At least the subsequent beamlets are shaped such that the grains of the previously irradiated and resolidified areas which border the edge areas melted by the subsequent beamlets grow into these resolidifying edges areas so as to substantially reduce or eliminate the artifacts.
US08476142B2
Aspects of the disclosure pertain to methods of preferentially filling narrow trenches with silicon oxide while not completely filling wider trenches and/or open areas. In embodiments, dielectric layers are deposited by flowing a silicon-containing precursor and ozone into a processing chamber such that a relatively dense first portion of a silicon oxide layer followed by a more porous (and more rapidly etched) second portion of the silicon oxide layer. Narrow trenches are filled with dense material whereas open areas are covered with a layer of dense material and more porous material. Dielectric material in wider trenches may be removed at this point with a wet etch while the dense material in narrow trenches is retained.
US08476115B2
A semiconductor device has an interposer with a die attach area interior to the interposer and cover attach area outside the die attach area. A channel is formed into a surface of the interposer within the cover attach area. A dam material is formed over the surface of the interposer within the cover attach area between the channel and edge of the interposer. A semiconductor die is mounted to the die attach area of the interposer. An adhesive material is deposited in the cover attach area away from the channel and dam material. A cover, such as a heat spreader or shielding layer, is mounted to the die and interposer within the cover attach area. The cover presses the adhesive material into the channel and against the dam material to control outward flow of the adhesive material. Alternatively, ACF can be formed over the interposer to mount the cover.
US08476114B2
A method for making a housing for an optoelectronic component is disclosed. The housing has a plastic base body that has a front side with an assembly region for at least one radiation emitting or radiation detecting body. The plastic base body is formed from at least one first plastic component and at least one second plastic component. The second plastic component is disposed on the front side of the plastic base body, and is formed from a material that differs from the first plastic component in at least one optical property, and forms an optically functional region of the plastic base body.
US08476111B2
A method of manufacture of an integrated circuit packaging system includes: providing a substrate having a through hole; mounting an integrated circuit in the through hole, the integrated circuit having an inactive side and a vertical side; connecting a first interconnect in direct contact with the integrated circuit and the substrate; applying a wire-in-film adhesive around and above the integrated circuit leaving a portion of the vertical side and the inactive side exposed and covering a portion of the first interconnect; and mounting a chip above the integrated circuit and in direct contact with the wire-in-film adhesive.
US08476094B2
A method for making light emitting diode, the method includes the following steps. First, a substrate having an epitaxial growth surface is provided. Second, a carbon nanotube layer is suspended above the epitaxial growth surface. Third, a first semiconductor layer, an active layer and a second semiconductor layer are grown on the epitaxial growth surface in that order. Fourth, a portion of the second semiconductor layer and the active layer is etched to expose a portion of the first semiconductor layer. Fifth, a first electrode is prepared on the first semiconductor layer and a second electrode is prepared on the second semiconductor layer.
US08476088B2
Provided is a light emitting diode (LED) having improved light emission efficiency, which can effectively overcome a technical limit of the related art by implementing a surface plasma resonance effect as well as reducing a layer defect such as threading dislocations in an LED structure.
US08476076B2
A method and apparatus for chromatography of a polyolefin polymer by flowing a solution of the polyolefin polymer through liquid flowing through a graphitic carbon liquid chromatography stationary phase. The method can be used to determine the monomer to comonomer ratio of a polyolefin copolymer such as a copolymer of ethylene and 1-octene or a copolymer of propylene and ethylene.
US08476067B2
A photobioreactor (100) for use in treating polluted air and producing biomass may comprise, at least in part, a generally vertical tube or fluidic pathway (102), a generally vertical helical tube or fluidic pathway (104) having a light source (106) partially positioned within the helical fluidic pathway (104), a head cap assembly (108), and a base assembly (110). In one illustrative example, the light source (106) may be a light emitting diode (LED) or a plurality of light emitting diodes (LEDs). By one approach, a gas diffusion apparatus (112) is located at the base assembly (110) adjacent the generally vertical fluidic pathway (102).
US08476066B2
The present invention is to present a bacteria analyzer comprising: a detector comprising: a light source for irradiating light on a measurement sample prepared from a specimen and a reagent; and a light receiving unit for receiving light generated by irradiating the light on the measurement sample from the light source; a scattergram data acquirer for acquiring scattergram data for generating a scattergram having information related to size of the bacteria contained in the specimen and fluorescence information generated by the bacteria as parameters; a bacteria number acquirer for acquiring number of bacteria contained in a plurality of regions on the scattergram for each region; and a form determiner for determining a form of the bacteria contained in the specimen.
US08476058B2
The invention relates to novel yeast strains, to the yeasts resulting from these strains, to a composition containing at least one Saccharomyces cerevisiae yeast and/or derivatives of a yeast having a particular interest as a food additive and/or probiotic and/or functional food and/or neutraceutic and/or functional ingredient and/or cosmeceutical and/or pharmaceutical active agent. The invention also relates to the use of the same in human and/or animal nutrition, or for the treatment or prevention of inflammatory diseases.
US08476048B2
Xylose-utilizing, ethanol producing strains of Zymomonas mobilis with improved performance in medium comprising biomass hydrolysate were isolated using an adaptation process. Independently isolated strains were found to have independent mutations in the same coding region. Mutation in this coding may be engineered to confer the improved phenotype.
US08476044B2
A nucleic acid molecule can be annealed to an appropriate immobilized primer. The primer can then be extended and the molecule and the primer can be separated from one another. The extended primer can then be annealed to another immobilized primer and the other primer can be extended. Both extended primers can then be separated from one another and can be used to provided further extended primers. The process can be repeated to provide amplified, immobilized nucleic acid molecules. These can be used for many different purposes, including sequencing, screening, diagnosis, in situ nucleic acid synthesis, monitoring gene expression, nucleic acid fingerprinting, etc.
US08476032B2
Assays for detection of bactericidal anti-Neisserial antibodies using a factor H polypeptide having a human amino acid sequence that mediates binding to Neisserial factor H binding protein (fHBp) are provided, as well as non-human animal models of Neisserial infection.
US08476025B2
The present invention is related to the discovery that phosphorylation of SP1 (SEQ ID NO.: 2) at serine residue 101 (known herein as phosphoserine101 Sp1) is an important part of a cell's response to DNA damage. This phosphorylation event is important for subsequent Sp1 localization to a site of DNA damage and is correlated with increased cellular viability in response to DNA damage.
US08476023B2
Methods for aiding in determining therapeutic efficacy of an aromatase inhibitor in a subject are provided according to embodiments of the present invention which include detecting expression and/or function of at least one UDP-glucuronosyltransferase having activity to modify at least one aromatase inhibitor and/or metabolite of the aromatase inhibitor by glucuronidation, wherein detection of expression and/or function of the UDP-glucuronosyltransferase is correlated with therapeutic efficacy of the aromatase inhibitor in the subject. Detection of UDP-glucuronosyltransferase expression and/or function includes detection of a UDP-glucuronosyltransferase gene deletion polymorphism in the subject.
US08476022B2
A method of making an array of nucleic acid colonies, by (a) providing a substrate having a patterned surface of features, wherein the features are spatially separated from each other on the surface of the substrate; (b) contacting the substrate with a solution of different target nucleic acids to seed a subset of the features that contact the solution, wherein each feature in the subset is seeded with a single nucleic acid from the solution, wherein a plurality of the features that contact the solution are not seeded with a nucleic acid from the solution; (c) amplifying the nucleic acids to form a nucleic acid colony at each of the features in the subset; and (d) repeating steps (b) and (c) to increase the number of the features on the surface that have a nucleic acid colony, thereby making an array of nucleic acid colonies.
US08476015B2
A method for separating and analyzing an analyte is provided which comprises, in a first position, transferring a liquid sample to a multiwell plate with a pipette tip, replacing the tips in the tip rack in the same position, and re-using the pipette tips for aspirating and dispensing liquid.
US08476011B1
A process for constructing a catalogued nucleic acid library in which the proportional representation of the constituents is adjusted to advantage through the use of disclosed technologies for positive and negative selection. The resultant benefit is that significantly fewer library constituents will need to be screened in order to identify a potentially desired constituent. Moreover, library constituents that previously would have been essentially “lost” are now recoverable. Preferred embodiments of this invention include the cataloguing, normalization, and enrichment of library constituents. By way of example, but not limitation, this technology is serviceable for constructing a library that contains an adequate representation of desirable constituents that (1) are initially found in low-copy numbers within a sample source or (2) originate from an organism that is problematic to culture. Applicable uses of this invention include any library-screening endeavor previously hindered by logistical impediments.By expanding previous logistical frontiers this invention allows for a novel generation of previously unattainable molecules—particularly molecules that are “unclonable” from conventional, unadjusted libraries—to now be detected, cloned, manipulated, expressed, studied, and used. By disclosing the construction and screening of high yielding nucleic acid libraries from mixed and uncultivated organisms, the instant technology eclipses former boundaries in the area of biological discovery and enables the full breadth of biological diversity to be accessed in the search for previously undiscovered genes and gene products. The benefits of the present invention are seen to extend to areas of diagnosis, medicine, agriculture, manufacturing, and academia.
US08476010B2
A sterile pharmaceutical composition for parenteral administration of propofol, said composition comprising propofol, optionally albumin, and less than about 10% by weight solvent for propofol, wherein said composition is stored in a container having a closure wherein said closure is inert to propofol.
US08476006B2
The present technology provides a cell based assay for identifying compounds that modulate store-operated ionic calcium levels using itpr mutant cell lines, such as itpr-ku cells, which have abnormal ionic calcium levels.
US08476003B2
An iterative rinse for fabrication of semiconductor devices is described. The iterative rinse includes a plurality of rinse cycles, wherein each of the plurality of rinse cycles has a different resistivity. The plurality of rinse cycles may include a first rinse of a semiconductor substrate with de-ionized (DI) water and carbon dioxide (CO2), followed by a second rinse the semiconductor substrate with DI water and CO2. The first rinse has a first resistivity; the second rinse has a second resistivity lower than the first resistivity.
US08475995B2
A toner has a core-shell structure including a toner core portion having a resin with an active hydrogenactive hydrogen containing group, a colorant and at least one additive, and a toner shell portion surrounding the toner core portion, wherein the toner shell portion includes a cross-linked resin prepared by reaction of at least a portion of the active hydrogen containing group and the cross-linking agent.
US08475994B2
A toner having charge control agents which impart excellent triboelectric charging characteristics. In embodiments, the toner particles are washed with a solution containing metal ions that impart desirable charging characteristics to the toner particles.
US08475991B2
A transparent toner for forming a glossy surface is disclosed, wherein a critical surface tension of a glossy surface formed by the transparent toner at 20° C. is at least 50 mN/m, and the transparent toner comprises a resin composed of a polymer formed by employing at least a polymerizable monomer containing a carboxylic group (—COOH). An image forming method employing the transparent tone is also disclosed.
US08475985B2
Compositions including carbon nanofoam are suitable for printing and magnetic ink.
US08475983B2
The presently disclosed embodiments are directed to imaging members used in electrostatography. More particularly, the embodiments pertain to electrophotographic imaging members which have an added-on protective overcoat layer formulated to comprise of a novel A-B diblock copolymer comprising two segmental blocks of a bisphenol polycarbonate and an organic acid terminal which provides chemical vapor contaminant resistive property. The overcoat layer may further be formulated to include small quantity of charge transport compound. The present embodiments provide superior copy printout quality.
US08475977B2
An extreme ultraviolet (EUV) lithography mask is provided. The EUV lithography mask includes a reflective layer and an absorptive layer deposited over the reflective layer. The absorptive layer is patterned so as to define absorptive regions of the mask for absorbing EUV radiation and reflective regions of the mask for reflecting EUV radiation. The EUV lithography mask further includes a protective capping layer which is deposited over both the absorptive regions and the reflective regions of the mask.
US08475971B2
A method of enhancing electrical performance of a membrane for a fuel cell is disclosed. The method includes providing a perfluorosulfonic acid (PFSA) ionomer in an aqueous hydroxylated hydrocarbon aqueous solution. The PFSA dispersion or solution has an acid number the same or higher than an acid number of the membrane. The membrane is immersed in the solution such that the high acid number PFSA dispersion diffuses into the membrane. After immersion, the removed membrane is then dried under tension.
US08475962B2
Composition for the manufacture of composite electrodes usable in electrochemical devices and comprising at least: (i) one lithium insertion material; (ii) one electronic conducting material; (iii) one amino-functional cationic polyelectrolyte; (iv) water.
US08475948B2
A magnetic recording medium suppresses an anticipated decline in performance due to heating of the lubricant layer and protective layer in thermally assisted recording, and has superior durability and reliability. The magnetic recording medium comprises a layer stack comprising, in order on a nonmagnetic substrate, at least a magnetic recording layer, adiabatic layer, carbon-based protective layer, and lubricant layer.
US08475944B2
A coated ceramic cutting insert for removing material from a workpiece, as well as a method for making the same, that includes a ceramic substrate with a rake surface and at least one flank surface wherein a cutting edge is at the juncture therebetween. A wear-resistant coating scheme that includes an alumina-containing base coating layer region, which has at least one exposed alumina coating layer, deposited by chemical vapor deposition on the substantially all of the surfaces of the ceramic substrate that experience wear during removal of material from the workpiece. The exposed alumina coating layer exhibits a blasted stress condition ranging between about 50 MPa (tensile stress) and about −2 GPa (compressive) as measured by XRD using the Psi tilt method and the (024) reflection of alumina. The exposed alumina coating layer is the result of wet blasting a titanium-containing outer coating layer region from the surface of the alumina-containing base coating layer region.
US08475942B2
A member covered with a hard coating having good wear resistance, a tool using the member, and a target for forming the hard coating are provided. A hard-coating-coated member has a hard coating on a substrate, in which the hard coating has a composition of (TiaCrbAlcSidYeRf)(CyNz), the R being at least one element selected from Ho, Sm, Dy and La, and when the subscripts a, b, c, d, e, f, y and z denote atomic ratios respectively, 0.05≦a≦0.3, 0.05≦b≦0.3, 0.4≦c≦0.65, 0≦d≦0.05, 0≦e≦0.05, 0.005≦f≦0.05, a+b+c+d+e+f=1, 0≦y≦0.3, 0.7≦z≦1, and y+z=1 are satisfied.
US08475939B2
An m-terphenyl derivative has a structure of formula (I) or (II): wherein A and B are five-membered heterocyclic compounds selected from the group consisting of pyrrole, pyrazole, imidazole, 1,2,3-triazole, 1,2,4-triazole, 1,2,3,4-tetrazole, 1,2-thiazole, 1,3-thiazole and 1,3,4-thiadiazole, each of substituents R, R1 and R2 is a member independently selected from the group consisting of H, halo, cyano, trifluoromethyl, amino, C1-C10 alkyl, C2-C10 alkenyl, C2-C10 alkynyl, C3-C20 cycloalkyl, C3-C20 cycloalkenyl, C1-C20 heterocycloalkyl, C1-C20 heterocycloalkenyl, aryl and heteroaryl. The compound of the present invention may have advantages in good electron affinity, low HOMO and thereby achieving hole blocking and may be used for electron transport material and/or electron injection material.
US08475935B2
Novel anthracene derivatives, novel materials capable of blue light emission with high color purity, and a light-emitting element, a light-emitting device, and an electronic device using any of the novel materials. The anthracene derivative represented by general formula (1) is provided. With the anthracene derivative, a light-emitting element with high emission efficiency can be provided. With the anthracene derivative, a light-emitting element emitting blue light with high color purity can be provided. In the formula, A1 represents a substituted or unsubstituted phenyl group, B1 represents any of an alkyl group having 1 to 4 carbon atoms or a substituted or unsubstituted phenyl group, α represents any of a substituted or unsubstituted phenylene group or a substituted or unsubstituted biphenyl-4,4′-diyl group, and R1 to R9 individually represent any of hydrogen, an alkyl group having 1 to 4 carbon atoms, or a substituted or unsubstituted phenyl group.
US08475931B2
Provided are a polarizer protective film containing a (meth)acrylic resin as a main component and being excellent in adhesion with a polarizer, a polarizing plate including the polarizer protective film and a polarizer which are unlikely to peel off from each other, and an image display apparatus of high quality using the polarizing plate. The polarizer protective film of the present invention includes a coating layer containing a (meth)acrylic resin (B) as a main component on at least one surface of a film containing a (meth)acrylic resin (A) as a main component.
US08475929B2
A laminated material having a barrier film containing a barrier layer on at least one surface of a substrate film that is a silicon oxide film having an atomic ratio in a range of Si:O:C=100:140 to 167:20 to 40, peak position of infrared-ray absorption due to Si—O—Si stretching vibration between 1060 to 1090 cm−1, a film density in a range of 2.6 to 2.8 g/cm3, and a distance between grains of 30 nm or shorter.
US08475925B2
A coating is a mixture of polybenzimidazole polymer and an epoxy. The coating may further include a primer underlying the coating. The coating may further include an adhesion promoter. A solution includes a polybenzimidazole polymer, an epoxy resin, an initiator, and a carrier solvent. The solution may further include a stabilizer and/or an adhesion promoter.
US08475921B2
A composite material includes an aggregate which contains a first metal particle constituting a core and second metal oxide particulates surrounding the first metal particle and having an average primary particle diameter ranging from 1 to 100 nm.
US08475920B2
Cable including at least one core comprising at least one transmissive element and at least one coating layer made of a coating material, wherein said coating material comprises: —at least one polyethylene; —at least one non-ionic surfactant having the following general formula (I): wherein: —Q is a p-functional group; —R is a linear or branched C1-C4 alkyl group, preferably a methyl group; —R1 is a hydrogen atom or a linear or branched C1-C6 alkyl group, preferably a hydrogen atom; —n is an integer from 2 to 5 inclusive, preferably 2; —x is an integer from 5 to 500 inclusive, preferably from 10 to 300 inclusive; —y is an integer from 0 to 500 inclusive, preferably from 10 to 300 inclusive; —z is an integer from 0 to 500 inclusive, preferably from 10 to 300 inclusive; —y+z is not lower than 2; —p is an integer from 1 to 4 inclusive, preferably 1 or 4; provided that, when the transmissive element is an electrical energy transmissive element, said at least one coating layer is an external sheathing layer. Preferably, said coating layer is an external sheathing layer having a protective function.
US08475919B2
A fiber blend for yarns and fabrics for use in military, fire-fighting, industrial work wear, and first responder protective clothing to provide multifunctional protection to the wearer, the fiber blend including an aramid fiber blend, wool fibers, and electrostatic dissipative fibers, wherein the aramid fiber blend includes meta-aramid fibers, para-aramid fibers and electrostatic dissipative fibers.
US08475914B2
Thick, compressible, multilayer labels with the appearance and feel of hard plastic identification shields comprise: A. A printable film having first and second opposing facial surfaces; B. A first adhesive having first and second opposing facial surfaces, the first facial surface of the adhesive in intimate contact with the second facial surface of the film; and C. Foam having first and second opposing facial surfaces, the first facial surface of the foam in intimate contact with the second facial surface of the first adhesive. In certain embodiments of the invention, the labels include one or more of a printable coating on the first facial surface of the film, a second adhesive in intimate contact with the second facial surface of the foam, and a release liner in contact with the second adhesive.
US08475910B2
Edge stiffened corrugated polymeric sheet material can be utilized as storm panels for mounting about a perimeter surface of an opening so as to protect the opening from wind and impact loads. The panels can include a corrugated sheet material having a corrugated contiguous band horizontally extending at about an end of the top and the bottom, wherein the corrugated contiguous band is complementary and contiguous to the plurality of corrugations of the corrugated sheet panel. The complementary and contiguous corrugated band can be configured to sandwich the sheet material. The panel may also include, individually or in combination, a contiguous band sandwiching the polymeric sheet material at a terminal end of each side and extending vertically from the top to the bottom. The panels provide wind and impact load protection for the opening.
US08475907B2
There is provided a silicon carbide-based porous body which can avoid excessive temperature elevation when it is used as a filter and the captured particulate matter (PM) is burnt for removal and which is low in strength reduction caused by heat cycle. The silicon carbide-based porous body comprises a plurality of silicon carbide (SiC) particles as an aggregate and a plurality of binding phases which bind the silicon carbide particles to each other, wherein of the binding phases, the phase having the largest volume is either of a Si phase and a phase (a metal silicide phase) made of at least one member selected from the group consisting of a Ti silicide, a Zr silicide, a Mo silicide and a W silicide, all having a linear thermal expansion coefficient at 40 to 800° C., higher than that of Si by at least 3×10−6 (° C.−1) and the phase having the next largest volume is the remainder of the Si phase and the metal silicide phase, and the binding phases contain the Si phase by 20 to 80% by volume of the total binding phases.
US08475902B2
A multilayer optical recording medium in which, as a recording layer is located farther from a surface of incidence of a light beam for reading, the amount of light that reaches the surface of incidence after being reflected off the recording layer is smaller.
US08475894B2
A honeycomb-shaped panel is formed from a plurality of generally sinusoidally shaped strips of molded fiberboard material each having spaced, oppositely directed flat peaks, the peaks of adjacent strips being secured together to form a plurality of hexagonally shaped cells extending perpendicular to the surfaces of the sheet. The strips may be cut from a single sheet of corrugated fiberboard sheet material and then secured together to form the honeycomb panel, or a plurality of such panels may be secured together face to face with their ribs aligned to form a stack, and selected cuts may be made through the secured, stacked panels to form a plurality of honeycomb panels of desired surface shape and height dimensions. The strips forming the cells are substantially rigid and resistant to collapse of the cells, and form a substantially rigid core when assembled between two flexible fiberboard skins, while the panel is bendable to adopt a desired panel curvature.
US08475891B2
This invention provides an embossed release paper that has high heat resistance and embossing properties. The embossed release paper comprises a paper base material, an ionizing radiation-cured resin layer, and a heat-cured silicone layer stacked in that order, the embossed release paper having embosses. The embossed release paper has high heat resistance and thus is suitable for use in synthetic leather production and melamine decorative sheet production that involve surface emboss pattern formation.
US08475885B2
The method of forming an organic film, includes: an organic film formation step of forming an organic film on a surface of a base member using a silane coupling agent; and a post-processing step including a water vapor introduction step of holding the base member on which the organic film has been formed in an atmosphere containing at least water vapor, and a dehydration processing step of holding the base member in an atmosphere having a smaller presence of water vapor than the atmosphere in the water vapor introduction step.
US08475884B2
Filler particles of a moisture-permeable, organic polymeric material are used in a polymeric coating composition, and this composition can be applied to a surface of a molded, fiber-reinforced polymeric material, such as sheet molding compound (SMC), to enable the electrostatic application of a layer of a powder primer to the same surface overlying the polymeric coating. And, when the molded SMC is heated to cure the powder primer layer, the out-gassing of moisture from the heated SMC does not result in defects on the surface of the molded SMC.
US08475883B2
The invention relates to an aqueous coating material for metallic substrates, comprising a water-dispersible and/or water-soluble polymer P with covalently bonded ligands A, which form chelates with the metal ions released during the corrosion of the substrate and/or with the substrate surface, and having crosslinking functional groups B, which with themselves, with further complementary functional groups B′ of the polymer P and/or with further functional groups B and/or B′ are able to form covalent bonds to crosslinkers V.
US08475881B1
The present invention is a method for forming a golf ball, the method comprising mixing an aqueous polyurethane dispersion with an azridine to form an aqueous polyurethane dispersion/aziridine mixture. Then, adding the aqueous polyurethane dispersion/aziridine mixture to a water tank, to form a PUD/aziridine solution and dipping a polybutadiene core in the PUD/aziridine solution. The PUD/aziridine solution comprises 0.4 percent aziridine, 4 percent aqueous polyurethane dispersion, and 95.6 percent de-ionized water, which forms a dipped polybutadiene core. The dipped polybutadiene core is then dried at room temperature.
US08475877B2
A method for counteracting the curling tendency of a gas barrier film having a tendency to curl up with a support side thereof facing inside, comprising (1) heating the gas barrier film from the support side thereof to thereby control the support temperature to fall between Tg and Tg+40° C., and (2) conveying the film in the roller circumferential direction within one second after the temperature of the support has reached Tg, while a part of the gas barrier layer of the gas barrier film is kept in contact with a film surface center part noncontact roller wherein Tg means the glass transition temperature of the support.
US08475874B2
The invention provides a process for depositing metallic layers from acidic or alkaline zinc or zinc alloy baths containing organic additives selected from brighteners, surfactants and complexing agents, a soluble zinc salt and optionally further metal salts selected from Fe, Ni, Co, Sn salts, wherein the bath can be purified continuously so that the process can be operated without interruption, as well as apparatus for carrying out this process.
US08475871B2
A building board, in particular of wooden material, plastic or a mixture of wooden material and plastic, with a top side and an underside and side edges. A polyurethane layer is applied at least on the top side. A decorative layer imitating a natural material is applied onto the polyurethane layer.
US08475870B2
A resin layer formation method and device for making a resin layer uniform on a substrate before lamination or on a substrate is provided. Adhesive is coated at an inner circumference side while rotating a substrate at low speed. A first adhesive layer is formed on the surface of the substrate by rotating at high speed. A step difference section is formed around a rotation center of the substrate by irradiating ultraviolet on an area in the inner circumference side of the first adhesive layer to hardening the area. Adhesive is coated at the rotation center side from the step difference section on the substrate, and a second adhesive layer is formed on the first adhesive layer by rotating the substrate at high speed. The first adhesive layer and the second adhesive layer are integrated to form a uniform adhesive layer.
US08475869B2
Disclosed are methods and systems for transferring dry or semi-dry nanoparticles onto a substrate. In one embodiment, this includes the steps of providing a roller comprising an elastomeric stamp; transferring nanoparticles in a dry or semi-dry state, and which contact the surface of a donor substrate, from the donor substrate onto the elastomeric stamp; and depositing the dry or semi-dry nanoparticles from the elastomeric stamp onto a receiver substrate by rolling the elastomeric stamp onto the receiver substrate. The substrate, in other embodiments, can have a relief structure.
US08475847B2
The invention relates to a dental, particularly a remineralizing composition, effective for pain sensitive teeth, such as toothpaste, tooth powder, mouth wash, chewing gum, dental formulations or the like, comprising spherical dental particles having a particle size between 0.1 and 2 μm made of silica gel in an one-part combination, comprising at least one combination agent selected from at least a phosphate, a oxide, a further oxygen-containing compound, a hydroxide, hydrogen carbonate or carbonate of the metals of groups II and III of the periodic system, as well as zinc or tin, wherein the dental particles are present in an amount such that the SiO2 amount resulting from the silica gel is less than 1 wt. %.
US08475834B2
A method of providing a pet with a benefit relating to effective assimilation of a lipid is described wherein the pet is administered, as a part of, or in addition to its regular diet, an edible composition that contains an ingredient that maintains, promotes or enhances the capacity of the pet to digest lipid efficiently. The invention extends to compositions for use in promoting lipid assimilation in pets, particularly senior or elderly pets. The compositions include pancreatic, liver and intestinal mucosa function-promoters. In embodiments, the liver function-promoter may be selected from taurine, emulsifiers, vitamins, minerals, glutathione and glutathione promoters.
US08475830B2
Biodegradable implants comprising dopamine modulating compounds are described.
US08475829B2
Biodegradable implants comprising dopamine modulating compounds are described.
US08475823B2
Effective treatments of pain for extended periods of time are provided. The treatments include the administration of one or more drug depots intraspinally wherein the drug depots include an effective amount of baclofen formulated within a polyorthoester. By administration of one or more drug depots, one can relieve pain caused by diverse sources, including but not limited to chronic pelvic pain syndromes, spinal disc herniation (i.e. sciatica), spondilothesis, stenosis, discongenic back pain and joint pain, as well as pain that is incidental to surgery. In some embodiments, the relief can be for at least thirty days, at least sixty days, at least one hundred days or at least one hundred and thirty-five days.
US08475813B2
A method of treatment for epilepsy and other disease states is described, which comprises delivery of gabapentin in a gastric retained dosage form.
US08475806B2
The invention provides a composition useful to prepare high titer influenza viruses, e.g., in the absence of helper virus, which includes a sequence from a high titer influenza virus isolate.
US08475804B2
The invention features compositions, methods, and kits useful for the treatment of filovirus-mediated diseases, e.g., hemorrhagic fever caused by Ebola virus, in an animal.
US08475803B2
The invention relates to the identification of mycobacterial antigens which are highly immunogenic and which may be used in assays and methods for the diagnosis of tuberculosis and the discrimination between infected animals and animals previously exposed to vaccines.
US08475802B2
Provided is a polypeptide having no more than 100 amino acids, which polypeptide has one or more sequences having at least 60% homology with any of SEQ ID 1-6, or has two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ ID 1DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ ID 2LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ ID 3DLIFLARSALILRGSVAHKSC SEQ ID 4PGIADIEDLTLLARSMVVVRP SEQ ID 5LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ ID 6IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.
US08475801B2
The present invention relates to the provision of novel immunogens comprising an antigenic IgE peptide preferably linked to an immunogenic carrier for the prevention, treatment or alleviation of IgE-mediated disorders. The invention further relates to methods for production of these medicaments, immunogenic compositions and pharmaceutical compositing thereof and their use in medicine.
US08475797B2
The present invention provides isolated anti-interferon alpha monoclonal antibodies, particularly human monoclonal antibodies, that inhibit the biological activity of multiple interferon (IFN) alpha subtypes but do not substantially inhibit the biological activity of IFN alpha 21 or the biological activity of either IFN beta or IFN omega. Immunoconjugates, bispecific molecules and pharmaceutical compositions comprising the antibodies of the invention are also provided. The invention also provides methods for inhibiting the biological activity of IFN alpha using the antibodies of the invention, as well as methods of treating disease or disorders mediated by IFN alpha, such as autoimmune diseases, transplant rejection and graft versus host disease, by administering the antibodies of the invention.
US08475795B2
Described herein are antibodies, and antigen-binding fragments thereof, that are specific for folate receptor alpha, related polynucleotides, expression vectors, and cells that express the described antibodies. Also provided are methods of using the described antibodies, and antigen-binding fragments thereof, and related kits. Provided herein are also methods for diagnosing cancers, such as breast cancer, thyroid cancer, colorectal cancer, endometrial cancer, fallopian tube cancer, ovarian cancer, or lung cancer, using the described antibodies, and antigen-binding fragments thereof. The methods involve determining the amount of folate receptor alpha in a sample derived from a subject and comparing this level with the level of folate receptor alpha in a control sample or reference sample.
US08475787B2
The invention relates to use of one or more bacteriophages in vivo in a human or animal in order to induce sensitivity to chemical antibiotics in bacterial cells, where such susceptibility is heritable, independent of continuing bacteriophage metabolism within those cells, and does not relate to the destruction of a biofilm to induce such sensitivity.
US08475780B2
The present invention provides methods and compositions for the treatment of ion imbalances. In particular, the invention provides compositions comprising potassium binding polymers and pharmaceutical compositions thereof. Methods of use of the polymeric and pharmaceutical compositions for therapeutic and/or prophylactic benefits are disclosed herein. Examples of these methods include the treatment of hyperkalemia, such as hyperkalemia caused by renal failure and/or the use of hyperkalemia causing drugs.
US08475779B2
The invention relates to novel methods and kits for treating or preventing disease through the administration of random copolymers comprising amino acids tyrosine (Y), phenylalanine (F), alanine (A), and lysine (K). The invention also relates to the treatment of autoimmune diseases, such as multiple sclerosis, and to the administration of random copolymers in treatment regimen comprising formulations that are administered at intervals greater than 24 hours, or to sustained release formulations which administer the copolymer over a period greater than 24 hours. The invention further relates to methods for conducting a pharmaceutical business comprising manufacturing, licensing, or distributing kits containing or relating to the formulations or dosing regimens of random copolymer described herein.
US08475777B2
Emulsions of high viscosity silicones are prepared by emulsifying a lower viscosity condensable silicone with a partial phosphate ester surfactant, and ripening the emulsion to obtain a higher viscosity silicone dispersed phase without generation of objectional amounts of octaorganocyclotetrasiloxanes. The emulsions are well suited for body care products.
US08475768B2
The present invention relates to chelators, in particular to chelators which are capable of forming complexes, i.e. paramagnetic chelates, with paramagnetic metal ions. The invention also relates to said paramagnetic chelates, said paramagnetic chelates linked to other molecules and their use as contrast agents in magnetic resonance imaging (MRI).
US08475762B2
A method and apparatus for providing an evenly mixed additive enhanced gypsum slurry to a web. Calcined gypsum and water are inserted into a mixer through at least one inlet of the mixer. The contents are agitated to form a slurry. The slurry is passed from an outlet of the mixer into a conduit. An additive is introduced into the slurry along a length of the conduit to achieve a flow stream of a slurry/additive mixture. A cross section of the flow stream is expanded in the conduit while not changing direction of the flow stream and a direction of the flow stream is changed while not expanding the cross section of the flow stream and conduit, all prior to the flow steam exiting from an outlet of the conduit.
US08475761B2
The present invention discloses a method for producing carbon nanocoils, which comprises: providing a metal substrate; depositing a tin precursor on the substrate; heating the substrate with the precursor to a predetermined temperature to form a catalyst on the substrate; placing the substrate in a quartz tube furnace; and introducing carbon source gas and protective gas into the quartz tube furnace to allow carbon nanocoils to grow on the surface of the catalyst. Another method for producing carbon nanocoils is also disclosed, which includes: depositing a mixed solution of iron acetate and tin acetate on a substrate; heating the substrate with the mixing solution to a predetermined temperature to form a catalyst on the substrate; placing the substrate in a quartz tube furnace; and introducing carbon source gas and protective gas into the quartz tube furnace to allow carbon nanocoils to grow on the surface of the catalyst.
US08475757B2
Amine stabilizing agents containing an azeotrope comprising water, an alcohol, and sodium hydride. Amine stabilizing agents containing water and a liquid silica hydroxide compound. Methods of making of amine stabilizing agents where solid silicon rock and sodium hydroxide are mixed with an ammonium/water solution to produce a green liquid in a first stage of the reaction. Alcohol is added and the alcohol fraction is separated from the non-alcohol fraction to produce an alcohol fraction product and a bottom fraction that is not soluble in alcohol or organics. The agents can be added to amines for stabilizing amines in anime processing of gases, in CO2 capture, in CO2 abatement systems and in other systems where amines are utilized to remove contaminants.
US08475754B2
An engine exhaust gas purification device comprising control unit having successively arranged switching device (1), counter-current heat exchanger (3) and at least one exhaust gas purification component (2). The switching device (1) has a first position where a flow path (6) of the exhaust gas to the exhaust gas purification component (2) is opened and a second position where a flow path (6) of the exhaust gas to the exhaust gas purification component (2) is blocked and the exhaust gas flows along a further flow path (7) where the exhaust gas is heated and conveyed, via a flow path (20) of the exhaust gas purification component (2), and exits the exhaust gas purification unit (5) through outlet channels (4) of the counter-current heat exchanger (3). The switching device, the exhaust gas purification component, the counter-current heat exchanger and the flow paths are integrated in a compact exhaust gas treatment unit.
US08475753B2
The present invention relates to an exhaust-gas aftertreatment system which comprises a preferably catalytically active particle filter (wall-flow filter) which is followed in turn by a throughflow monolith (flow-through monolith) which is preferably provided with a catalytically active function. Both components have the same storage functions for gaseous substances present in the exhaust gas of internal combustion engines. The system is suitable in particular for the simultaneous removal of particles and pollutants from the exhaust gas of both predominantly lean-operated internal combustion engines and also of internal combustion engines operated predominantly with a stoichiometric air/fuel mixture. Likewise described is a process for the production and the use of such a system for exhaust-gas aftertreatment.
US08475741B2
Provided is a droplet discharging device that can precisely dispense large flow rate of droplets and small flow rate of droplets selectively. The droplet discharging device according to the present invention includes a pneumatic discharger for discharging a droplet having a first flow rate, and an electronic pipette for discharging or sucking a droplet having a second flow rate equal to or smaller than the first flow rate. The pneumatic discharger includes, i) a storage chamber for storing a liquid, ii) an air tank connected to the storage chamber through a first air pipe and supplying compressed air to the storage chamber to push the liquid of the storage chamber outside, and iii) a first nozzle connected to the storage chamber through the liquid pipe and receiving the liquid pushed out of the storage chamber to discharge droplets.
US08475737B2
Fluidic connectors, methods, and devices for performing analyses (e.g., immunoassays) in microfluidic systems are provided. In some embodiments, a fluidic connector having a fluid path is used to connect two independent channels formed in a substrate so as to allow fluid communication between the two independent channels. One or both of the independent channels may be pre-filled with reagents (e.g., antibody solutions, washing buffers and amplification reagents), which can be used to perform the analysis. These reagents may be stored in the channels of the substrate for long periods amounts of time (e.g., 1 year) prior to use.
US08475734B2
A filtering apparatus for filtering a fluid includes a filter element for filtering the fluid and an adhesive capillary structure for generating capillary forces. The adhesive capillary structure is attached to the filter element by using an adhesive property of the adhesive capillary structure. The adhesive capillary structure is preferentially made of a double-sided tape, which is adhesive on two sides. The filtering apparatus further includes a filtering location where the filter element is located, and a detection location where a property of the fluid is detectable. The capillary structure is formed such that the filtered fluid is guided from the filtering location to the detection location.
US08475732B2
In some aspects, a modular analyte measurement system having a replaceable strip port module is provided to permit contaminated modules to be replaced. Some aspects of the present disclosure relate to barriers for strip ports or the sealing of strip ports and/or analyte measurement devices to maintain a clean strip port and/or enable the strip port to be cleaned for reuse. Cleaning tools are also provided. Also provided are strip port interfaces that guide fluid away from the strip port opening, as well as absorptive elements that prevent fluid from entering a strip port. Analyte measurement devices with gravity sensors or accelerometers are also provided, along with methods related thereto. Also provided is a docking station that serves as an information server and provides storage and recharging capabilities.
US08475729B2
A method of forming a honeycomb reactor or reactor component is disclosed, including the steps of providing a honeycomb structure having cells divided by cell walls, providing an array of cutting tools arrayed in a pattern so as to be able to simultaneously align with a first plurality of the cell walls at a first end of the structure, and cutting the walls of the first plurality, reducing their height. Systems utilizing the reactors or reactor components thus formed are also disclosed.
US08475728B2
Device for mixing gas and for distributing the resulting mixture to the inlet of a catalytic reactor
A device for mixing and distributing two gases upstream of the catalytic zone of a reactor by producing a homogeneous mixture and a profile of velocities which are as flat as possible. The device uses a plurality of internal chambers (I) enclosed in an external chamber (II), the external chamber communicating with each of the internal chambers via orifices pierced in the wall of said internal chambers (I) at a well-defined height. The external chamber (II) is provided with a perforated plate placed at a distance H2 from the inlet pipe for said chamber (II). The device is applied to the inlet of an autothermal reactor.
US08475722B2
The present invention provides a hydrogen generation device using a photocatalyst to generate hydrogen from liquid water or water vapor and a method of using the same. The hydrogen generation device of the present invention has a water channel through which liquid water or water vapor flows, and which has an outer circumferential wall made at least in part of a transparent material; a hydrogen channel through which hydrogen flows and which is located at the inner circumference side of the water channel; a hydrogen separating membrane forming at least part of a wall between the water channel and hydrogen channel, separating hydrogen from the liquid water or water vapor in the water channel, and providing the hydrogen to the hydrogen channel; and a photocatalyst layer arranged on least at part of the water channel-side surface of the hydrogen separating membrane.
US08475720B2
The disclosure relates to a device for removing and analyzing a sample from a polymerization reactor including one or more sample conduits for removing a sample from the reactor and transferring the sample to a sample flash tank, whereby the conduits are in communication with the reactor and are provided with at least two sampling valves; a sample flash tank for separating said solid particles and evaporated gas, whereby the sample flash tanks are connected to the conduits and provided with a device for analyzing evaporated gas, and including a sample receiver for purifying the solid particles. The receivers are connected to the sample flash tanks and provided with an apparatus for analyzing the solid particles. The disclosure includes a method for improving a polymerization reaction.
US08475719B1
An electric censer includes a censer body, a receiving unit and an incense branch. The censer body is a hollow container with an opening defined at a top thereof. The receiving unit is received in the censer body and includes a hollow tube communicating with the opening of the censer body. The incense branch includes a light guiding bar and a light emitting unit positioned on a bottom end the light guiding bar. A top end of the light guiding bar extends outwardly from the opening of the censer body and act as a light outputting side of the incense branch. The position of the light emitting unit is adjustable by pressing or pulling the light guiding bar.
US08475714B2
According to embodiments of the invention, a selective ultraviolet disinfection method is provided. The method includes selecting operating parameters for an ultraviolet disinfection process of flowing liquid carrying first and second types of entities to affect the first type of entities while the second type of entities remains intact, illuminating the liquid with ultraviolet light according to the operating parameters and continuously adjusting the operating parameters based on real-time measurements of ultraviolet transmission and flow rate of the liquid.
US08475710B2
A method of producing a cemented carbide body provides: (1) a grain refiner compound comprising a grain refiner and carbon and/or nitrogen, and, (2) a grain growth promoter, on at least one portion of the surface of a compact of a WC-based starting material comprising one or more hard-phase components and a binder, and then sinters the compact. The invention also relates to a cemented carbide body comprising a WC-based hard phase and a binder phase, wherein at least one part of an intermediate surface zone has a lower average binder content than a part further into the body, and at least one part of an upper surface zone has in average a larger average WC grain size than the intermediate surface zone. The cemented carbide body can be used as a cutting tool insert for metal machining, an insert for a mining tool, or a coldforming tool.
US08475708B2
An improved post clamp for a molten metal pump includes a support post clamp that supports the weight of a pump superstructure on the top of the support posts. The clamp preferably includes (a) a bottom flange for connecting to the pump superstructure, (b) a cavity for receiving an end of a support post, wherein the end has a top surface, and (c) a top flange for being positioned above the top surface. In operation the top flange rests on the top surface of the support post thereby supporting at least part of the weight of the superstructure. It is preferred that a plurality of support posts and post clamps according to the invention be used with a molten metal pump wherein the top surface of each support post supports some of the weight of the superstructure. Also disclosed are novel support posts that may be used with the post clamp, and a pump in which the post clamp and/or support posts may be used.
US08475705B1
This invention describes a unique of class of nano-scale materials for use as protective coatings or barriers against heat as well as material loss due to processes such as corrosion, ablation, erosion, or oxidation. These nano-scale laminated materials are also useful as free-standing components and as substrates, especially for high temperature oxidation-resistant applications. The novel materials of this invention are known as interface-defined nano-laminates (IDnLs), and are fabricated by a new method from ceramic, metallic, and other powders. The laminate layer thickness in an IDnL is smaller than that of ordinary laminates but greater than that of superlattices. Interface-defined nano-laminates are fundamentally different from ordinary laminates in that their properties are defined by interfaces, and not by the properties of the bulk materials comprising individual layers.
US08475699B2
A method for rounding at least a part of an edge of an opening in a tubular body formed of thermo-formable material, wherein a mandrel is brought into contact with the edge and the mandrel has a temperature that allows it to permanently deform the material of the tubular body and a product thereof.
US08475698B2
A method of making a carbon nanopipe and ensemble of carbon nanopipes, comprising the steps of flowing a carbon precursor over silica fibers and thereby depositing a durable graphitizable carbon coating of tunable thickness of about 10-500 nm onto the silica fibers and etching away the silica fibers to yield a three-dimensional mat of electronically networked, hollow carbon tubules. A carbon nanopipe comprising a durable graphitizable carbon wall of tunable thickness of about 10-500 nm formed by exposing a silica fiber network to a carbon precursor vapor and thereby depositing a carbon film onto the silica fiber network at a temperature suitable for complete pyrolysis of the carbon precursor and removing the silica fibers.
US08475692B2
Nanofibers are manufactured while preventing explosions from occurring due to solvent evaporation. An effusing unit (201) which effuses solution (300) into a space, a first charging unit (202) which electrically charges the solution (300) by applying an electric charge to the solution (300), a guiding unit (206) which forms an air channel for guiding the manufactured nanofibers (301), a gas flow generating unit (203) which generates, inside the guiding unit (206), gas flow for transporting the nanofibers, a diffusing unit (240) which diffusing the nanofibers (301) guided by the guiding unit (206), a collecting apparatus which electrically attracts and collects the nanofibers (301), and a drawing unit (102) which draws the gas flow together with the evaporated component evaporated from the solution (300) are included.
US08475681B2
Neutron scintillating materials are provided, including boron substitution scintillation materials, boron and Li substitution scintillation materials, and Gd-based substitution scintillation materials.
US08475672B2
The present invention provides a plasma processing device and a plasma processing method that can easily adjust plasma density distribution while making the plasma density uniform, and a method of manufacturing an element including a substrate to be processed. In an embodiment of the present invention, the inside of a vacuum vessel (1) is divided by a grid (4) having communication holes into a plasma generation chamber (2) and a plasma processing chamber (5). On the upper wall (26) of the plasma generation chamber (2), magnetic coils (12) are arranged such that magnetic field lines within the vacuum vessel (1) point from the center of the vacuum vessel (1) to a side wall (27), and, outside the side wall (27) of the plasma generation chamber (2), ring-shaped permanent magnets (13) are arranged such that a polarity pointing to the inside of the vacuum vessel (1) is a north pole and a polarity pointing to the outside of the vacuum vessel (1) is a south pole.
US08475662B2
The present invention relates to a process for separating at least one first material from a mixture comprising this at least one first material and at least one second material using magnetic particles with which the at least one first material agglomerates.
US08475661B2
This invention relates to heterogenous pore polymer nanotube membranes useful in filtration, such as reverse osmosis desalination, nanofiltration, ultrafiltration and gas separation.
US08475659B2
A strainer wall structure that removes foreign substances from a fluid suctioned into a pipe and a re-circulation pump that is part of an emergency core cooling system (ECCS). The strainer wall structure has an inlet side and an outlet side through which cooling water is introduced and discharged, respectively, and includes a body having an opening in a direction of the inlet side, closed side surfaces, and an outlet port disposed at one of the closed side surfaces. The strainer includes a punched plate filter screen inserted into the opening. A modular cassette apparatus including grooved first filter plates is inserted into the body, and second filter plates having second grooves is inserted into the first grooves.
US08475657B2
The method and device for filtering liquid in an aquarium, the filtration device made by the liquid filtration method comprises a box-shaped casing, the filtration bodies and filtration materials are set inside the casing, wherein the casing includes a water inlet set around the casing and grid panels set inside both sides of the casing; the filtration bodies include an inner filtration body set inside the grid panels and an outer filtration body set outside the grid panels; the filtration materials are filled inside the casing, between the inner filtration body and grid panels; in this way, the liquid to be filtered enters into the casing through the water inlet and flows out from the grid panels, and proceeds further from the casing via the inner filtration body, filtration materials and outer filtration body treatment. The liquid filtration device has the advantages of being an integrated replacement as a filtration consumable, good universality, convenient installation and maintenance, large filtration area and effective prevention of dirt left after filtration from a backflow.
US08475653B2
A water treatment apparatus includes a plurality of meshed tubes made of synthetic yarn and provided with cilia; a plurality of tube stack cages containing the meshed tubes; and an aeration diffuser positioned between the tube stack cages and configured to provide air so that to-be-treated influent water moves to the tube stack cages. The hollow interior of the filter media, i.e. meshed tubes, enables water to move in any direction, and the high porosity maximizes the area for filtering of suspended solids and attachment of microorganisms. The resulting efficiency of removal of suspended solids and soluble organic material is far greater than conventional methods. Arrangement of diffusers in the middle of the reaction tank and between the tube stack cages and aeration by them result in perfect mixing in the reaction tank. The load of suspended solids and soluble organic materials is evenly distributed over the entire filer media.
US08475651B2
Contact of a crude feed with one or more catalysts produces a total product that includes a crude product. The crude product is a liquid mixture at 25° C. and 0.101 MPa. The one or more catalysts may include a catalyst that has a median pore diameter of at least 90 Å. One or more properties of the crude product may be changed by at least 10% relative to the respective properties of the crude feed.
US08475648B2
Processes and catalyst systems are provided for dewaxing a heavy hydrocarbon feedstock to form a lubricant base oil. A layered catalyst system of the present invention may comprise a first hydroisomerization dewaxing catalyst disposed upstream from a second hydroisomerization dewaxing catalyst. Each of the first and second hydroisomerization dewaxing catalysts may be selective for the isomerization of n-paraffins. The first hydroisomerization catalyst has a first level of selectivity for the isomerization of n-paraffins, the second hydroisomerization dewaxing catalyst has a second level of selectivity for the isomerization of n-paraffins, and a layered catalyst system comprising the first and second hydroisomerization dewaxing catalysts has a third level of selectivity for the isomerization of n-paraffins. The third level of selectivity may be higher than each of the first level of selectivity and the second level of selectivity.
US08475643B2
To provide an anodic oxidation method, a titanium oxide film manufacturing method and a catalyst carrying method which is suitable, for example, for anodic oxidation of aluminum, titanium and catalyst carrying on the surface of alumite (registered trademark), capable of generating an oxide film at a low cost and rapidly by eliminating the use of a strongly acid or strongly basic electrolytic solution and using a carbonated water as an electrolytic solution, capable of controlling the sealing treatment of oxide film through a simple method, capable of effecting the oxide film dyeing and catalyst carrying rationally and easily, and capable of effecting the catalyst carrying safely and surely without eroding a base material.An object (3) to be treated is electrolyzed in an electrolytic solution received in a treatment vessel (1) serving the object (3) as an anodic electrode.It is an anodic oxidation method in which an oxide film is generated on the surface of the object (3).A carbonated water of a predetermined acid concentration generated by dissolving a pressurized carbon dioxide in a predetermined quantity of water (7) is used as the electrolytic solution.
US08475626B2
An evaporator for evaporating a liquid containing fluid, having an inlet and an outlet connected to an evaporation volume with an internal structure, the inlet and the outlet defining a main flow path there between and the cross-section of the evaporation volume is substantially constant along the main flow path is described. A method method for evaporating a liquid containing fluid by providing an evaporator supplying a liquid containing feed stream to the inlet; exerting heat; choosing the operating conditions so that an annular flow is created.
US08475624B2
A plasma etch processing chamber configured to clean a bevel edge of a substrate is provided. The chamber includes a bottom edge electrode and a top edge electrode defined over the bottom edge electrode. The top edge electrode and the bottom edge electrode are configured to generate a cleaning plasma to clean the bevel edge of the substrate. The chamber includes a gas feed defined through a top surface of the processing chamber. The gas feed introduces a processing gas for striking the cleaning plasma at a location in the processing chamber that is between an axis of the substrate and the top edge electrode. A pump out port is defined through the top surface of the chamber and the pump out port located along a center axis of the substrate. A method for cleaning a bevel edge of a substrate is also provided.
US08475619B2
The invention relates to a process for improving the adhesion of a layer made of a material that is crosslinkable by exposure to UV rays to a substrate, and also to a process for manufacturing a transistor comprising at least one step of performing such a process.This process for improving the adhesion of a layer made of a material M to the surface of a substrate S is characterized in that: the material M is a material that is crosslinkable by exposure to UV rays, and in that it comprises the following steps: a) deposition, on at least one surface of the substrate S, of a nonpolymerized polymerizable composition P, comprising at least one molecule F comprising a first reactive group F1 that is capable of reacting, by exposure to UV rays, with a reactive group M1 of the surface of the material M, and a second reactive group F2 that is capable of forming bonds with the material(s) constituting the surface of the substrate S, b) deposition, onto the layer of the nonpolymerized composition P obtained in step a), of a layer made of a noncrosslinked material M, and c) exposure to UV rays of the three-layer structure obtained in step b). The invention finds application in particular in the field of manufacturing transistors.
US08475613B2
A bonding agent is provided which includes a flux containing either calcium aluminate or calcium oxide and aluminum oxide and aluminum nitride powder.
US08475612B2
A method for bonding a first wafer on a second wafer by molecular adhesion, where the wafers have an initial radial misalignment between them. The method includes bringing the two wafers into contact so as to initiate the propagation of a bonding wave between the two wafers while a predefined bonding curvature is imposed on at least one of the two wafers during the contacting step as a function of the initial radial misalignment.
US08475605B2
In the steel for a surface layer hardening which is treated with carburizing in a temperature range of 800° C. to 900° C., chemical composition thereof contains, by mass %, C: 0.10% to 0.60%, Si: 0.01% to 2.50%, Mn: 0.20% to 2.00%, S: 0.0001% to 0.10%, Cr: 2.00% to 5.00%, Al: 0.001% to 0.50%, N: 0.0020% to 0.020%, P: 0.001% to 0.050%, and O: 0.0001% to 0.0030%; the remaining portion thereof includes Fe and unavoidable impurities; and the total amount of Cr, Si, and Mn satisfies, by mass %, 2.0≦Cr+Si+Mn≦8.0.
US08475604B2
A tank cleaning device is provided, comprising a base member; a conduit attached to the base member having an inlet, an upper outlet, and a lower outlet; and a plurality of adjustable legs connected to and extending below the base member. The inlet of the conduit accepts a cleaning fluid, and a cleaning nozzle is attached to either the upper outlet or the lower outlet. A method of cleaning the tank is also provided, comprising placing the mounting device at a first location, spraying the tank with the cleaning fluid until a selected portion of the tank is cleaned, discontinuing the supply of cleaning fluid, and then repositioning the mounting device to a second location within the tank and resuming the supply of cleaning fluid. Multiple mounting devices may be employed and periodically repositioned within the tank to achieve quick and effective cleaning.
US08475602B2
A substrate cleaning method for cleaning and removing foreign materials adhered to a surface of a substrate includes heating the substrate to peel off the foreign materials from the surface of the substrate by a thermal stress, removing the foreign materials from the surface of the substrate by a temperature gradient created in a proximity of the surface of the substrate, and collecting the foreign materials removed from the surface of the substrate by a collecting unit facing the substrate.
US08475594B2
A continuous galvanizing line uses a coating pot containing a molten zinc bath having bottom dross and further comprises a pump. The pump agitates the bottom dross so the bottom dross interacts with aluminum and converts to top dross, which can be removed without needing to stop the galvanizing line. A reaction vessel may also be used to provide a higher concentration of aluminum to react with the bottom dross.
US08475581B2
De-polluting, self-cleaning coating compositions are disclosed which comprise photocatalytic titanium dioxide and a binder comprising an epoxy siloxane polymer. The compositions produce durable, self-cleaning coatings with photocatalytic activity against pollutants in the air, such as NOx compounds.
US08475580B2
An ink jet ink including a self-dispersible pigment, a salt, a polyoxyethylene alkyl ether and a water-soluble organic solvent. The self-dispersible pigment is a pigment to a surface of a particle of which a functional group containing at least a phosphonic acid group is bonded, the introduced amount of the functional group bonded to the self-dispersible pigment is 0.10 to 0.33 mmol/g. The salt is constituted by combining a specific cation with a specific anion. The value (Concentration of anion)×(Valence number of anion) of the salt in the ink is 0.005 to 0.06 mol/L. The water-soluble organic solvent includes glycerol, the content of which in the ink is 35% to 78% by mass based on the total content of the water-soluble organic solvent in the ink.
US08475573B2
The present invention relates generally to the field of emission control equipment for boilers, heaters, kilns, or other flue gas-, or combustion gas-, generating devices (e.g., those located at power plants, processing plants, etc.) and, in particular to a new and useful method and apparatus for preventing the plugging, blockage and/or contamination of an SCR catalyst. In another embodiment, the method and apparatus of the present invention is designed to protect an SCR catalyst from plugging and/or blockage from large particle ash that may be generated during combustion.
US08475572B2
The invention relates to a method of removing carbon dioxide from a fluid stream by a fluid separation assembly. The fluid separation assembly has a cyclonic fluid separator with a tubular throat portion arranged between a converging fluid inlet section and a diverging fluid outlet section and a swirl creating device. The separation vessel has a tubular section positioned on and in connection with a collecting tank. In the method, a fluid stream with carbon dioxide is provided. Subsequently, a swirling motion is imparted to the fluid stream so as to induce outward movement. The swirling fluid stream is then expanded such that components of carbon dioxide in a meta-stable state within the fluid stream are formed. Subsequently, the outward fluid stream with the components of carbon dioxide is extracted from the cyclonic fluid separator and provided as a mixture to the separation vessel. The mixture is then guided through the tubular section towards the collecting tank while providing processing conditions such that solid carbon dioxide is formed. Finally, solidified carbon dioxide is extracted.
US08475556B2
A secondary filter cartridge radially nested within and radially supported by a main filter cartridge. The secondary cartridge has a flexible multi-leg crown “with slits” which engage a receptacle of the main filter element for radial support and a central pin projection interior to the crown extending outwards to protect the crown from impact damage. The main filter cartridge bottom end disk has axially extending, spaced apart projections engaged into matching pockets or gaps provided between engaging inward projections on an interior end face of the filter housing, rotationally fixing or locking the filter housing and the main filter cartridge. The main filter cartridge includes an anti-rotation housing engagement member extending through a filter housing wall to the exterior indicating presence of a properly installed filter cartridge and rotatably locking position of the housing and main filter cartridge.
US08475542B2
A method for producing a fuel or fuel additive comprising providing a reaction mixture comprising oil and an alcohol in an oil-in-alcohol emulsion and a catalyst for converting the oil to the fuel or the fuel additive. The oil and the alcohol are reacted in the presence of the catalyst, at a concentration below that used in a conventional batch process, to produce the fuel or fuel additive. This low level of catalyst reduces the formation of diols and oxidation products that can diminish the quality of the fuel or fuel additive. The fuel or fuel additive produced is continuously removed during the reaction, effectively de-coupling the concentration of catalyst used from the rate of the two phase reaction.
US08475538B2
A process for aftertreating dyed and/or printed textiles to remove excess portions of colorants comprises utilizing an aqueous formulation comprising at least one graft copolymer having a hydrophilic main chain and also surfactants.
US08475536B2
Biomedical implants (e.g., orthopedic implants) with modified surfaces that can enhance a cement bond's strength (e.g., tensile, shear, and/or fatigue) are disclosed, along with methods of manufacturing and using such implants. The implants can exhibit a variety of physical, chemical, or process-derived features which can enhance cement bonding. For instance, the implant surface can exhibit particular roughness values, and/or be substantially free of non native material. Processes for producing such implants can include providing a first roughened implant surface, which can be produced, for example, by particle blasting. A treatment formulation can be applied to the first roughened surface to create a second roughened surface that exhibits enhanced cement bonding properties relative to the first roughened surface. In some instances, the first roughened surface and the second roughened surface can exhibit substantially similar Ra values. The second roughened surface can exhibit a negative Rsk value.
US08475532B2
An instrument for inserting an elongated hydrogel prosthesis into an intervertebral disc includes an insertion cannula that is inserted through the annulus fibrosus of an intervertebral disc to provide access to the nucleus region of the disc, an elongated hydrogel prosthesis packaged within a tubular container adapted to be coupled to a proximal end of the insertion cannula, and a source of fluid pressure adapted to be coupled to a proximal end of the tubular container. Auxiliary instruments for use in convenient insertion of the insertion cannula through the nucleus pulposus and providing for a complete and controlled passage of the hydrogel prosthesis through the insertion cannula are provided in a kit with the insertion cannula. A sizing apparatus for determining the volume of prosthesis to be inserted includes a catheter or cannula capable of being inserted through the insertion cannula into the nucleus region of the intervertebral disc and having at its distal end a balloon capable of being inflated within the intervertebral disc with a measurable volume of a fluid in order to determine the amount of hydrogel prosthesis to be injected.
US08475529B2
An accommodating intraocular lens, for use in an eye, is made from flexible, optionally elastic, bio-compatible lens body material surrounding a closed and sealed lens cavity. One or more compressible struts is in the cavity. The cavity is filled with bio-compatible optical liquid. The optical liquid has a refractive index sufficiently high to, in cooperation with the ciliary muscle and the compressible strut, focus light, incident on the eye, on the retina, thus to provide accommodation. The curvature of the surface of the lens is deformable, by the forces expressed by the ciliary body and the strut, thus to change the radius of curvature of the anterior body member and/or the posterior body member, thus providing focusing, including from relatively farther distance in the relaxed state to relatively nearer distance in the accommodative state.
US08475527B2
A lens and cartridge packaging system and method of use which simplify the removal and transfer of an IOL to an IOL insertion device is disclosed. The packaging system enables a user to easily load an IOL into a cartridge without the use of forceps. In addition, the packaging system also allows a user to fold and insert the IOL into a cartridge without damaging the IOL and/or compromising IOL sterility. In addition, the related methods of use minimize and/or eliminate damage to the IOL during unpackaging, folding, transfer and loading procedures.
US08475526B2
An IOL injector body including an injector body segment defining a portion of a lumen, and a first loading chamber component coupled to the injector body segments and a second loading chamber component hingedly coupled to the first loading chamber component. The second loading chamber component is capable of rotating about an axis that is parallel to the lumen. An IOL vial including a vial base and an injector guide rotatably mounted in said base, whereby an injector can be inserted along the injector guide and rotated such that a folded IOL can be obtained in the injector. A method of loading an IOL injector with an IOL the method that comprises inserting the IOL injector body into a vial and rotating the IOL injector body relative to the vial to obtain the IOL in the IOL injector body.
US08475510B2
Disclosed are embodiments of airflow applicators used for delivering directional, heated air to, for example, the scalp and hair of humans and/or animals to eliminate ectoparasites, such as lice and lice eggs. In preferred embodiments, the applicators are configured to deliver heated airflow (from a separate device, or from another portion of a single device, that generates heated airflow) efficiently right to where ectoparasites and their eggs most frequently reside. Also disclosed are treatment methods, including preferred treatment patterns, for delivering heated airflows for use in eliminating ectoparasites and their eggs on an animal.
US08475503B2
Methods for forming molded orthopedic implants with at least one mesh substrate having opposing upper and lower primary surfaces. At least a major portion of the mesh substrate lower primary surface is integrally moldably attached to the molded implant body. The methods are carried out so that the mesh substrate has at least one selectively exposed region devoid of molded material that exposes at least a portion of the mesh substrate upper surface to at least a partial thickness of the mesh substrate so as to allow for tissue in-growth in the at least one exposed region of the mesh substrate.
US08475493B2
A surgical staple for connecting two tubular tissue structures may include a substantially rectangular base having a first edge and a second edge substantially parallel to one another, and a third edge substantially perpendicular to the first and said second edges; and may also include at least three deformable tines extending from the first and second edges of said base; where no tine that extends from the first edge may be positioned at substantially the same distance from the third edge as any said tine that extends from the second edge; and where deformation of the tines secures the tubular tissue structures together.
US08475490B2
Methods and devices are provided for providing access through tissue to a surgical site. A surgical access device can be configured to be positioned in tissue to provide access through a working channel of the access device to a body cavity underlying the tissue. The access device can include a sealing element positioned at least partially within the working channel. The sealing element can be formed of a puncturable self-sealing material such as a gel and/or a foam configured to provide a channel seal that seals the working channel when no instrument is inserted through the sealing element and configured to provide an instrument seal that provides a seal around one or more surgical instruments inserted through the sealing element.
US08475484B2
A sealing assembly hinders or prevents air or other fluid from seeping between various components of a medical device by use of a liquid seal. An infusion port is for introducing a sealing liquid to immerse a flood space between a liner that surrounds a torque tube and/or within the torque tube, thereby creating a liquid seal around the torque tube and lubricating the torque tube. The length of the liner and the cross sectional space of the flood space are adjusted to control flow rate. An aspiration port may force suction pressure into a lumen extending along the length of the medical device in a distal direction. The liquid seal also prevents diluting of the suction pressure by stopping ingress of air.
US08475482B2
A surgical instrument includes a main unit and a suction conduit. The main unit includes at least one tubular body having a distal end, a proximal end, and an inlet disposed near the distal end. The suction conduit is slidably disposed over the main unit, and is slidably movable along the main unit between a retracted position, at which the suction conduit does not cover the inlet of the main unit, and an extended position at which the suction conduit covers the inlet of the main unit and a suction inlet of the suction conduit is placed in fluid-communication with the main unit inlet. The surgical instrument can be used as a suction tool by placing the suction conduit in the extended position and applying a vacuum through the inlet of the main unit and the suction inlet.
US08475476B2
A device and method for accessing the interior of a cavity of a patient is described. The transmural access system includes an overtube for use with an endoscope, a safety trocar, suture anchors, and a suture exchanger. The overtube is deployed in conjunction with an endoscope through a selected body passageway of a patient to locate a sight for an access portal. The distal end of the multi-lumen overtube is secured to an interior body wall of the selected access portal. A safety trocar is advanced through the main lumen of the overtube to form the access portal to the body cavity. Upon completion of the desired medical procedure, the access portal can be closed by deploying a suture exchanger.
US08475467B2
Treatment of spinal irregularities, including, in one or more embodiments, derotation apparatus and systems that can be used to reduce the rotation of vertebral bodies. Derotation apparatus that may comprise a tube assembly comprising an inner sleeve and an outer sleeve disposed over the inner sleeve. The inner sleeve may have a distal end for attachment to an implant. The tube assembly may further comprise a handle assembly. The tube assembly may further comprise a ball joint assembly disposed between the tube assembly and the handle assembly. The ball joint assembly may comprise a ball joint configured for attachment to a coupling rod.
US08475466B2
A torque-limiting driver for orthopedic surgical use is described. The torque-limiting driver has a housing to which a torque force may be applied and transferred to a driver output shaft. The housing encloses a cam bearing assembly having a ball cage disposed so that balls of the ball cage move along a first vector path (Vr) radial to the axis of rotation. The bearing assembly also has an inner race abutting the ball. The inner race travels along a second vector path (F) parallel to the axis of rotation. The first vector path (Vr) and the second vector path (F) are not co-axial. A bearing load assembly applies a bias force (F) to the inner race of the cam bearing assembly to set the calibrated maximum amount of torque that can be transmitted via the housing through the cam bearing assembly to the output shaft of the torque-limiting driver.
US08475465B2
A tool for separating an acetabular shell of a hip prosthesis from the surrounding pelvic bone includes a fixture which attaches to the acetabular shell and has a chisel guide mounted on it. A chisel associated with the chisel guide is curved to conform to the outer periphery of the acetabular shell, and the chisel guide causes the chisel to circumscribe the acetabular shell as the chisel is inserted between the acetabular shell and the pelvis.
US08475462B2
The present invention provides a device for segmenting a bone. The bone is segmented in two cuts i.e. an initial cut and a final cut. While segmenting the bone, the device is clamped to the bone directly or with the help of a block attached to the bone. An initial cut is taken after the clamping is performed. An upper part of the device is then moved to a predetermined length and the final cut is taken. Thus, the device enables an accurate length of cut to be taken while segmenting the bone. The device also enables varied length of cuts to be taken while segmenting the bone.
US08475452B2
Disclosed herein are high efficiency surgical devices and methods of using same using radio frequency (RF) electrical power and/or electrically heated filaments to destroy tumors, form lesions, denaturize, desiccate, coagulate and ablate soft tissues, as well as to drill, cut, resect and vaporize soft tissues. According to the principles of this invention, the electrosurgical instruments can be used with externally supplied conductive or non-conductive liquids, as well as without externally supplied liquids, a mode of operation often referred to as “dry field” environment.
US08475448B2
A catheter with temperature sensing has a catheter body and a tip section with integrated thermoresistive temperature sensors on its outer surface. The temperature sensor includes a microfabricated thin film assembly of which one layer is a sensor layer of thermoresistive material. In one embodiment, the tip section has a flexible tubing on whose outer surface circumferential temperature sensors are integrated. In another embodiment, the tip section has a tip electrode on whose outer surface a tip temperature sensor is integrated. In yet another embodiment, the tip section has a tip temperature sensor integrated on its tip electrode and multiple circumferential temperature sensors distal of the tip temperature sensor.
US08475446B2
A method for mitigating leakage in an RF electrosurgical generator includes delivering an RF signal from an RF electrosurgical generator to an electrosurgical electrode by way of a patient box; providing a balanced and symmetrical shielded transmission line coupling said electrosurgical generator disposed in a first housing to said patient box disposed in a second, different housing; providing a common mode choke in said patient box, said common mode choke including an output winding and a return winding, said output winding and said return winding spaced apart and in parallel to maintain a desired impedance, said output winding comprising a wire carrying said RF signal as an output signal and said return winding carrying a return signal from a return electrode; and directing a common mode signal from said RF signal to said common mode choke thereby blocking said common mode signal.
US08475444B2
A hemostatic surgical blade is described which is formed of five symmetrically disposed layers. A martensitic stainless steel core is provided with oppositely disposed faces which are bonded to hard pure copper thermal transfer layers which, in turn, are supported by buttressing layers of austenitic stainless steel. The blade is heated by a blade heater circuit which is provided as a flexible circuit carrying one or more resistor heaters and associated leads supported by a polyimide substrate. A thermally conductive and electrically insulative adhesive is used to bond the flexible circuit to a blade blank. The system employs a multi-lead cable which is removable from an instrument handle. One blade embodiment involves an elongate stem for accessing body cavities and another embodiment incorporates a controller function within an instrument handle.
US08475443B2
A heating-type balloon catheter device is provided. The catheter device may include a heating-type balloon at a top end portion of a catheter main body and a vibration imparting device connected to a base end portion of the catheter main body. The vibration imparting device may impart vibration to a liquid for heating in the heating-type balloon and include an elastic tube with a base end portion connected to the catheter main body and with a top end portion thereof closed. The elastic tube may be filled with a liquid for heating. A vibrator device having a roller rotating about a rotary shaft at a position offset to the rotary shaft may be provided. The elastic tube may be set to such a vibrator device so that a predetermined direction of rotation of the roller extends from the side of the base end portion of the elastic tube to the side of the top end portion thereof and a margin volume part which is not pressed with the roller is provided on the side of the top end portion of the elastic tube.
US08475439B2
A wavefront sensor is integrated with a surgical microscope for allowing a doctor to make repeated wavefront measurements of a patient's eye while the patient remains on an operating table in the surgical position. The device includes a wavefront sensor optically aligned with a surgical microscope such that their fields of view at least partially overlap. The inclusion of lightweight, compact diffractive optical components in the wavefront sensor allows the integrated device to be supported on a balancing mechanism above a patient's head during a surgical procedure. As a result, the need to reposition the device and/or the patient between measuring optical properties of the eye and performing surgical procedures on the eye is eliminated. Many surgical procedures may be improved or enhanced using the integrated device, including but not limited to cataract surgery, Conductive Keratoplasty, Lasik surgery, and corneal corrective surgery.
US08475433B2
The invention relates to a suction ring (2) for ophthalmic surgery, with a first suction region (4), which is designed to suck the suction ring onto an eye (18), and with a second suction region (10), which is designed to aspirate a functional element (12). The functional element and/or the suction ring may exhibit measuring means. The functional element may be formed in the manner of a container, so that it can receive a liquid which in operation is located between the cornea of the eye and a lens.
US08475423B2
An absorbent garment, such as a diaper, designed to reduce or eliminate any tendency of the garment to droop when loaded. The absorbent garment includes an absorbent chassis that defines a waist opening and two leg openings. Based on dimensions of the garment, the absorbent chassis suitably has a diaper length ratio of about 0.85 or less, a droop design ratio of about 150 millimeters or less, and/or an absorbent length design ratio of about 280 millimeters or less.
US08475413B2
A drive device for advancing an advancing element (2; 33) relative to a housing (1; 30) over a entire advancing distance (G) comprises a tensioning device having a tensioning element (3; 39) for tensioning a spring device (4). A predetermined distance (A) between the tensioning element (39) and the advancing element (33) or between the counter element (7) and the tensioning element (3) that engages with advancing element can be set according to the advancing of the advancing element (2; 33) by a partial advancing distance that is less than the entire advancing distance (G). According to a method for discharging a fluid product from a container (16) via an outlet (17), a plunger (18) is displaced inside the container (16) by means of a drive device provided with an advancing element (2; 33) and with a spring device (4), whereby the spring device (4) is tensioned by a tensioning device according to the advancing of the advancing element (2; 33) by a partial advancing distance.
US08475412B2
A fluid delivery device includes an array of needles, each in fluid communication with a respective reservoir. Respective actuators are coupled so as to be operable to drive fluid from the reservoirs via needle ports. Each needle can have a plurality of ports, and the ports can be arranged to deliver a substantially equal amount of fluid at any given location along its length. A driver is coupled to the actuators to selectively control the rate, volume, and direction of flow of fluid through the needles. The device can simultaneously deliver a plurality of fluid agents along respective axes in solid tissue in vivo. If thereafter resected, the tissue can be sectioned for evaluation of an effect of each agent on the tissue, and based on the evaluation, candidate agents selected or deselected for clinical trials or therapy, and subjects selected or deselected for clinical trials or therapeutic treatment.
US08475411B2
Systems, kits, and methods for programming infusion systems are disclosed. A system comprises an infusion device and a mock pump set. The infusion device is programmable with at least one infusion protocol. The infusion device includes a pathway adapted to receive a pump set and at least one pump adapted to pump fluid through the pump set when the pump set is received in the pathway. The mock pump set is sized to be received in the pathway of the infusion device, and is not configured to receive fluid from the fluid container. A kit comprises the mock pump set. A method comprises inserting a mock pump set in a pathway of an infusion device and programming the infusion device with at least one infusion protocol while the mock pump set is received in the pathway.
US08475410B2
According to one embodiment, a cannula assembly may include a cannula module and an inserter module. In the pre-operational state the cannula is retracted with respect to the skin-contacting surface. In operational state the cannula projects beyond the skin-contacting surface. The inserter module may include an energy store and an activation mechanism. When the energy store is at least partially discharged, the stored potential energy is transformed to kinetic energy that moves the cannula from the pre-operational state to the operational state. The activation mechanism is triggerable from outside the cannula assembly with a trigger device. The activation mechanism prevents the energy store from being discharged before it is triggered by the trigger device, and enables the energy store to be discharge after it is triggered by the trigger device to force the cannula from the pre-operational state into the operational state.
US08475402B2
An aspiration tube has a relatively high fluidic resistance. The tube is coupled to a medical device and a pump of an aspiration system. The tube can be designed to create a pressure drop that at least equals the maximum vacuum pressure of the pump. The fluidic resistance can be accomplished with a tube having an inner diameter less than 0.05 inches. The aspiration tube and an irrigation tube may be coupled to an anterior chamber of a cornea during a phaco procedure. The aspiration tube is sized so that even if a maximum pressure occurs, the resultant aspiration flowrate will be such that the cornea will not be damaged when an occlusion is cleared from the tube. An in-line filter may also be attached to the aspiration tube to filter out particles in the system.
US08475394B1
A kit and method for collecting, storing and transporting genetic samples from an animal to a storage facility. The kit comprises at least a collection swab, a protective tube, a follicle sample collection card, and an extraction device. The collection swab is housed within a sterile protective package. The collection swab has a shaft connected at one end by a collection head. The collection swab includes a cap and plug, wherein the cap is encircled around the shaft of the collection swab. The protective tube is adapted to receive the collection head of the collection swab. The follicle sample collection card has a protective backing covering an adhesive strip disposed on the follicle sample collection card. The extraction device is provided to pull at least one hair with follicle from the animal. The kit may also include a specimen storage enrollment card to record pertinent information, and an envelope may be provided for storage and delivery of the protective tube and the follicle sample collection card including the respective genetic samples to a storage facility for processing and storage of the genetic samples at a controlled temperature above freezing.
US08475391B2
A method is presented to address quantitative assessment of spatial distractor tasks in a subject, where the method comprises the steps of: (1) presenting at least one scene to a subject on a display, said scene comprising a plurality of elements and a background; (2) modulating the saliency of a predetermined section of the scene; (3) receiving feedback from the subject; (4) superimposing an additional cue onto the scene; (5) generating a shift in attention of the subject; (6) receiving refined feedback from the subject; (7) quantitatively refining the refined feedback; (8) adjusting the motion associated with the scene relative to accuracy of the refined feedback; and (9) calculating a critical threshold parameter for the subject; and (10) recording the critical threshold parameter onto a tangible computer readable medium. An apparatus for quantitative assessment of spatial distractor tasks of a subject comprising a display device, an input device, a control device, and a tangible computer readable medium. In its simplest sense, quantitative assessment profile of spatial distractor tasks by psychophysical responses is generated on a tangible computer readable medium.
US08475389B2
A pneumostoma assessment and treatment system includes methods and devices for aftercare of a pneumostoma. In particular, methods and devices are provided for standardized monitoring and assessment of pneumostoma patency thereby facilitating the establishment of standards-based protocols for pneumostoma management. Methods of standardized pneumostoma patency assessment includes the use of devices for raising alveolar pressure to a controlled repeatable pressure above ambient while analyzing gas flow through the pneumostoma. In response to an assessment the functionality of the pneumostoma, the tissues of the pneumostoma may be treated with a treatment device utilizing one or more different modalities to preserve or enhance the health and function of the pneumostoma.
US08475382B2
An ultrasound diagnostic apparatus includes a transmitting and receiving unit that transmits an ultrasound wave to a target object and receives the ultrasound wave as ultrasound data reflected from the target object including a long axis direction blood vessel. An image generation unit generates an ultrasound image as a sectional image of the blood vessel. A region of interest (ROI) setting unit sets a first ROI on a vertical straight line at a right angle to the long axis direction and a second ROI on a wall of the blood vessel displayed at a designated time. A tracing unit traces movement of tissue in the target object corresponding to the first and second ROIs from the designated time to sequentially following thereafter by a gradient method using a spatial brightness gradient. A second memory unit stores information of the movement of the tissue for a predetermined duration.
US08475376B2
In a medical imaging apparatus for imaging mammary gland and breast while compressing the breast with a compression plate, the posture of an ultrasonic probe relative to the compression plate is kept constant and the moving motion of the ultrasonic probe is stabilized. The apparatus includes: an imaging stage; a compression plate; an ultrasonic probe provided to maintain acoustic connection to the compression plate, for transmitting ultrasonic waves according to drive signals and receiving ultrasonic echoes to output reception signals; an ultrasonic imaging unit for supplying the drive signals to the ultrasonic probe and generating image data based on the reception signals; a detecting unit for detecting a location and/or a posture of the ultrasonic probe relative to the compression plate; and a control unit for controlling the location and/or the posture of the ultrasonic probe based on a detection result of the detecting unit.
US08475367B1
A biometric monitoring device comprising a platform to support the body weight of the user; a body weight sensor to generate data which is representative of the user's weight, processing circuitry to calculate the user's weight, a user interface (e.g., a visual display, coupled to the processing circuitry, to display the weight of the user); and communication circuitry (implementing, e.g., wired, wireless and/or optical techniques) to: (1) receive user identification data (is any data that identifies a particular user, a particular device and/or from which a particular user or device may be determined) from an external portable activity monitoring device, (2) receive activity data from the external portable activity monitoring device, and (3) transmit the activity data to a data storage which is (i) external to the biometric monitoring device and (ii) associated with the user identification data.
US08475357B2
An apparatus and method of use are disclosed to treat urological disorders. The biocompatible device includes a handle, needle, dilator and sling assembly configured to be minimally invasive and provide sufficient support to the target site. In addition, the configuration of the sling assembly also allows the sling to be adjusted during and/or after implantation. The device and treatment procedure are highly effective and produce little to no side effects or complications. Further, operative risks, pain, infections and post operative stays are reduced, thereby improving patient quality of life.
US08475354B2
Described are methods, devices, and systems for a novel, inexpensive, easy to use therapy for a number of disorders. Described are methods and devices to treat disorders that involves no medication. Methods and devices described herein use alternating magnetic fields to gently “tune” the brain and affect mood, focus, and cognition of subjects.
US08475334B2
A load-sensitive automatic transmission system for an agricultural electric vehicle is provided, which includes a drive motor for generating a rotational power using electric power of a battery; a transmission for changing a rotational speed of the drive motor in multiple stages and outputting the changed rotational speed; a forward/reverse differential gear for transmitting the power of the transmission to wheels; a control unit for detecting a running state of the vehicle and a load state of the drive motor and determining a speed change time; and an actuator for operating the transmission in response to a signal from the control unit. Accordingly, it is possible to selectively provide high speed and torque to meet the needs of different situation, beyond the limitations of the motor drive performance of a conventional electric vehicle.
US08475330B2
The invention relates to a method and a device for controlling a creep mode of a vehicle having a hybrid drive system (1, 1′), having a parallel hybrid drivetrain (2, 2′) comprising an internal combustion engine (3), at least one electrical machine (5), a first switching element (4) designed as a frictional element and disposed between the internal combustion engine (3) and the electrical machine (5), by means of which the internal combustion engine (3) can be connected to the electrical machine (5), a gearbox (7), an output (26), and at least one second switching element (6) designed as a frictional element and disposed between the electrical machine (5) and the output (26), by means of which the electrical machine (5) can be operationally connected to the output (26). In order to allow low-cost, effective long-term creeping that is gentle on the components, and thereby ensures reliable availability of electrical energy for electrical loads of the vehicle, the creep mode is alternately implemented by an internal combustion engine creep mode generated by means of operating at least one switching element (6, 27) in slip, and an electrical motor creep mode at least supported by means of the electrical machine (5).
US08475327B2
An accelerating system for improving the running speed of a bicycle including: a main hub housing, a hub bush engaged with the main hub housing and having a sun gear, a gear cover having latches and having fixed shafts for rotatably supporting planetary gears in a meshing engagement with the sun gear, a gear housing having a ring gear with a gear-type engaging portion positioned on the hub shaft such that the planetary gears engage with the ring gear, a locker threadedly engaged with the gear-type engaging member, a hollow cylindrical auxiliary hub housing having an inner stage portion for receiving an outer periphery surface of the gear housing, and an auxiliary hub housing cover having a gear latch portion for engaging with the latches of the gear cover such that the auxiliary hub housing cover only rotates in one direction.
US08475322B2
An automatic transmission includes a double-pinion planetary gearset and two single-pinion planetary gearsets. A first ring gear is held stationary. A second sun gear and a third ring gear are coupled to a first sun gear and a first carrier respectively, constituting first and second rotor units. An output is coupled to a third carrier. A first clutch selectively couples a second carrier to the first rotor unit. A second clutch selectively couples the second carrier to the second rotor unit. A third clutch selectively couples an input to the second carrier. A fourth clutch selectively couples a second ring gear to a third sun gear. A fifth clutch selectively couples the second ring gear to the third carrier. A sixth clutch selectively couples the input to the third sun gear. Nine forward gear ratios and one reverse gear ratio are obtained by simultaneous application of three of the clutches.
US08475321B2
A differential assembly having a gearset, which has first and second side gears and a plurality of pinion sets, and a case assembly. Each pinion set has a first pinion meshingly engaged to the first side gear, and a second pinion meshingly engaged to both the second side gear and the first pinion gear. The case assembly has a case structure, a case cover and a gearset mount. The case structure defines a cavity into which the gearset mount is received. The gearset mount defines a plurality of first pinion bores into which the first pinions are received, a plurality of second pinion bores into which the second pinions are received and a side gear pocket into which the first side gear is received. The gearset mount is fixedly and non-rotatably coupled to the case cover. The case cover is separately coupled to the case structure.
US08475320B2
A bearing preload adjuster assembly can include a first annular member defining a first outer wall having a threaded region and a first inner wall having a plurality of first ramped surfaces formed thereon. The first outer wall can threadably engage a corresponding threaded region of an axle assembly. A second annular member can define a second outer wall having a plurality of second ramped surfaces formed thereon and can be received in the first annular member such that the second outer wall faces the first inner wall. A biasing member can bias the second annular member in a first axial direction such that the plurality of second ramped surfaces are in selective meshed engagement with the plurality of first ramped surfaces. A retaining member can be coupled to the first inner wall and can retain the biasing member and second annular member within the first annular member.
US08475314B2
An axle assembly includes an axle housing assembly including a housing structure having an interior cavity with a sump, a lubricant disposed in the sump having a liquid lubricant level, and a differential mounted in the axle housing assembly for rotation about a first axis. The differential includes a ring gear generating an annular stream of lubricant adjoining the ring gear above the liquid lubricant level during operation of the differential at a rotational speed greater than a predetermined rotational speed. The housing structure includes an interior surface on which a deflector is coupled. The deflector extends into the interior cavity and has a first face having an impingement portion and a first edge adjacent the impingement portion. The impingement portion extends into the stream and deflects a portion of the stream towards the first edge. The first edge disperses the portion of the stream into the cavity.
US08475311B2
A hybrid power driving system for a vehicle comprises an internal-combustion engine, a first electric motor, a second electric motor, a planetary coupling mechanism, a speed-reduction mechanism and a differential mechanism. An output shaft of the internal-combustion engine is connected with an input shaft of the first electric motor, and an output shaft of the first electric motor is connected with an output shaft of the second electric motor via a first clutch. The output shaft of the second electric motor is connected with one of a sun gear and a ring gear of the planetary coupling mechanism at a position of the output shaft along its axial direction. And the output shaft of the second electric motor is connected with the other one of a sun gear and a ring gear at another position of the output shaft along the axial direction via a second clutch.
US08475310B2
In a friction transmission belt in which a compression rubber layer provided to an inner circumferential side of the belt body is wrapped over pulleys such that the compression rubber layer contacts the pulleys, such a configuration that both of a noise reduction and durability while the belt is running can be achieved is obtained. The compression rubber layer is configured so as not to include short fibers and so as to have a surface roughness, i.e., an Ra of at least a pulley contact surface of the compression rubber layer equal to or more than 3 μm.
US08475303B2
An interface component for engaging an arrow tip to the leading end of an arrow shaft. The device directs impact forces axially and eliminates the shearing and wall collapse of arrow shafts caused by conventional collared arrow head engagement devices which tend to collapse and cut the leading edge of arrow shafts on hard impacts. Engagement to the arrow shaft leading end is provided by an elongated member axially engaged with the bore of the arrow shaft. The exterior surface of the device can be surfaced to interact with passing air during flight of the arrow and increase spin for better accuracy.
US08475300B2
A method of evaluating a golf club is disclosed. The method includes a step (St1) of determining motions of the golf club during a swinging motion of a golf player including a period ranging from a time (Ts) to a time (Tf); a step (St2) of obtaining in a time series power index values (Pw) during the period ranging from the time (Ts) to the time (Tf), based on the result of the determination; a step (St3) of obtaining a power integration value (Sp) by integrating the power index values (Pw) during the period ranging from the time (Ts) to the time (Tf); a step (St4) of calculating club energy (Eg) of the golf club at the time (Tf); and a step (St5) of quantitatively evaluating club suitability based on the power integration value (Sp) and the club energy (Eg). Each of the power index values (Pw) is a value which is correlated to a power of a work provided from the golf player to the golf club.
US08475299B2
A golf ball having a plurality of dimples formed on its outer surface, the outer surface of the golf ball being divided into plural areas with dimples such that the golf ball is spherically symmetrical as defined by the United States Golf Association (USGA) Symmetry Rules, the plural areas configured such that the golf ball exhibits a lift coefficient (CL) of less than about 0.230 over a range of Reynolds Number (Re) from about 120,000 to about 180,000 and at a spin rate of about 3,500 rpm.
US08475295B2
A high forgiveness wood-type golf club head comprises a body and a face. The body defines an interior cavity and comprises a sole that forms a bottom portion of the golf club head, a crown that forms a top portion of the golf club head and a skirt that forms a periphery of the golf club head between the sole and the crown. The face place is positioned at a front portion of the golf club head opposite a rear portion of the golf club head. The body defines an outer periphery having a generally triangular shape in plan.
US08475292B2
Wood-type golf clubs as described herein may include: (a) a hosel to receive a golf club shaft; (b) a club head; and (c) a ball striking face. The club head include may include: a plurality of weights, a plurality of tubes, and an exterior cover structure (e.g., an exterior skin) that covers at least a portion of the plurality of weights and at least a portion of the plurality of tubes, and wherein the exterior cover structure defines the shape of the club head. Additionally, the ball striking face may be engaged with at least two of the plurality of weights and/or at least two of the tubes. The plurality of weights may include a first weight, a second weight, a third weight, and a fourth weight that are all engaged with the striking face.
US08475287B2
A method for changing a theme associated with a given space (e.g., restaurant). A wall system includes a wall panel having multiple themes depicted thereon or multiple wall panels each having a theme depicted thereon. Using a series of winches, chain drives, cables and pulleys or the like, the wall panels are moved to change the theme of the space. A ceiling system includes two ceiling panels movable via a series of winches, chain drives, cables and pulleys. Once separated the ceiling panels expose a theme different than that depicted while closed. Audio and/or visual cues may be provided to alert patrons to a theme change.
US08475285B2
An amusement device having a display, a memory and a controller. The amusement device includes a housing defining an internal cavity and a chassis secured to the housing and defining a chassis plane. The chassis is positioned at least partially within the internal cavity. A control board support defines a board plane and the control board support has a closed position and an open position. In the closed position, the board plane is generally perpendicular to the chassis plane and in the open position, the board plane is generally parallel to the chassis plane. The control board support is slidably and rotatably movable between the closed position and the open position. The control board support is positioned within the internal cavity in the open and closed positions and when moving therebetween.
US08475281B2
Various application-centric user interface techniques are described. A user can easily launch, add, or update applications. An application-centric activity center can be presented as part of a user interface for an operating system shell. A file defining metadata for an application can be defined. The techniques can be applied to game-related software.
US08475271B2
A gaming system includes a control and management device which determines a link attraction based on gaming information sent from each of a plurality of gaming apparatuses. The control and management device identifies a target gaming apparatus in which a prize is generated and at least one neighboring gaming apparatus, based on the gaming information. The control and management device judges whether the link attraction for the plurality of gaming apparatuses has already been determined, when the gaming information is winning information. Further, the control and management device determines the link attraction by reference to a link attraction mode lottery table stored in a memory, if it is determined the link attraction has not yet been determined. The control and management device determines a unit number and, subsequently, sends the link attraction to the target gaming apparatus with the unit number and the at least one neighboring gaming apparatus.
US08475268B2
A method for awarding a jackpot, and a corresponding gaming machine and system. The jackpot is awarded based upon a presence of scatter symbols appearing in a game outcome in a predefined manner. The jackpot is preferably linked across multiple machines. In a preferred form, scatter symbols on one reel may be in an active or inactive state, the jackpot is awarded only if they are in the active state, and the probability of them being in an active state is dependent upon the size of the player's wager, so as to provide linear returns to players.
US08475262B2
In various embodiments, the gaming system, gaming device, and method disclosed herein maintains a designated award which is associated with a variable score for a skill-based game. In one such embodiment, the gaming system enables a player to play a game, wherein the gaming system forms a score for the player. The player's formed score is based on zero, one or more inputs made by the player during the play of the skill-based game (i.e., which tends to measure one or more aspects of that player's skills). If the player's score does not reach the variable score associated with the designated award, the gaming system modifies the variable score associated with the designated award of that skill-based game. If the player's score reaches or exceeds the variable score associated with the designated award, the gaming system provides the player a designated quantity of opportunities to win the maintained designated award.
US08475259B2
A reel-type secondary game is played simultaneously with a conventional reel-type main game on a gaming machine. The secondary game is initiated only after the player meets certain criteria, such as betting additional credits. Once the secondary game is initiated, one or more special symbols are added to the leftmost reel and the rightmost reel used in the main game, but not the reels in-between. The added special symbols do not affect the symbols used in the main game. All the reels containing the symbols used in the main game and the one or more special symbols are rotated and randomly stopped. Awards are granted for winning symbol combinations obtained in the main game. If the special symbols align with a certain stop position, a special bonus game is played or the player wins a progressive jackpot.
US08475254B2
Embodiments of the present concept provide gaming devices configured for linked game play. First and second gaming devices that are separately playable by first and second players are electronically linked so that a gaming event being played at the first gaming device may also be being played at the second gaming device. Also provided is a method of sharing game play across multiple gaming devices, where the method includes receiving a wager from a first player at a first gaming device, receiving a wager from a second player at a second gaming device, initiating a gaming event that is displayed at the first and second gaming devices, and awarding prizes associated with gaming outcomes displayed at the first and second gaming devices. These and other arrangements of the present concept may allow cooperative or competitive game play between the first and second player.
US08475253B1
Various embodiments of the present disclosure provide a gaming system, gaming device, and method providing a card game having a discarded card re-insertion feature. Upon receiving a primary wager, the gaming system provides a play of a card game in which the gaming system enables the player to select one or more cards in a player's hand to discard and in which, if the gaming system discards any of the cards in the player's hand, the gaming system replaces at least one of the discarded cards with a replacement card. The gaming system enables the player to place an optional secondary wager to cause the gaming system to activate the discarded card re-insertion feature. If the discarded card re-insertion feature is active, the gaming system enables the player to cause zero or at least one of any discarded cards to be re-inserted into the player's hand.
US08475252B2
An automatic multiple player gaming machine includes a central game processor and multiple player terminals, wherein each player terminal includes a player input and a player display. The gaming machine also includes a common game display and a game program residing in the processor, wherein the game program executes an interactive multiple player game. The processor further displays individual hands of cards on each player display, wherein each hand of cards is randomly selected from its own set of cards. The operation of such a machine may be effected in a computer-based method as well.
US08475251B2
This invention relates to a method and apparatus for providing a coding competition. In one embodiment, a method for providing a coding competition includes transmitting a coding problem to contestants, receiving computer code created by a contestant, determining a response of the computer code to test data, and evaluating the response of the computer code to the test data. In another embodiment, a method for evaluating a skill level of a contestant includes electronically communicating a coding problem to contestants, electronically receiving a software program in response to the coding problem from one of the contestants, evaluating the received software program, awarding points to the contestant based on the received software program, and determining a rating for the contestant for the competition based on the number of points awarded to the contestant.
US08475243B2
A coin dispensing and storing device includes a body, coin collecting tubes, a left rotatable support, a pivotal plate and a right rotatable support. Coins are received in the coin collecting tubes. The left rotatable support is pivotally connected to one side of the body. The left rotatable support allows a portion of the coin collecting tubes to be disposed therein. The pivotal plate is pivotally connected to the other side of the body. The right rotatable support is connected to the pivotal plate. The right rotatable support allows the remaining portion of the coin collecting tubes to be disposed therein. The left and the right rotatable supports can be pivotally received in or rotated to the outside of the body. With this arrangement, the operation is labor-saving. Further, the force exerting on the respective rotatable supports can be distributed efficiently to reduce the generation of damage and deformation.
US08475238B2
A polishing pad may include a base and a plurality of polishing protrusions on a surface of the base. Each polishing protrusion may include a sidewall defining an opening in a surface of the polishing protrusion opposite the base. In addition, portions of the sidewall opposite the base may define a contact surface.
US08475231B2
A flexible membrane includes a horizontal central portion, a vertical portion coupled to the central portion, a thick rim portion coupled to the vertical portion, and an extension coupled to the thick rim portion. An outer surface of the horizontal central portion provides a mounting surface configured to receive a substrate. The thick rim portion has a thickness that is greater than a portion directly adjacent to the thick rim portion. The thick rim portion is between the extension and the vertical portion and a greatest dimension of the extension is less than the thickness of the thick rim portion.
US08475219B2
Disclosed herein is an apparatus. The apparatus includes a first body, a second body, and an electronic circuit. The first body includes a first end, a second end, and a middle section. The first body further includes a first conductor receiving area and a recessed cavity. The first receiving area extends from the first end to the second end. The cavity is at the middle section. The second body is adapted to be removably connected to the first body. The second body includes a first end, a second end, and a second conductor receiving area. The second conductor receiving area extends from the first end to the second end. The apparatus is adapted to receive an electrical conductor between the first receiving area and the second receiving area. The electronic circuit is at the cavity. The electronic circuit is configured to receive reference information corresponding to the electrical conductor.
US08475208B2
An electrical connector including a dielectric body and electrical contacts held by the dielectric body. The electrical contacts have a pair of signal contacts with respective mating ends configured to engage a communication connector and also with respective wire-terminating ends. The wire-terminating ends are located proximate to each other in a cable-termination region and are configured to mechanically and electrically couple to corresponding signal conductors of a cable. The electrical connector also includes a ground shield having a cover extension that extends over the cable-termination region. The cover extension is configured to shield the cable-termination region.
US08475201B2
A mechanical insulation displacement connection system which creates an electrical connection between an enamel insulated wire and a terminal inserted in a special seat or pocket. The enamel insulated wire is wound at the beginning and end of the winding onto a central pin in the seat. The terminal is provided with two, sufficiently flexible inner tabs which, during insertion of the terminal in the seat, slide over the enamel insulated wire removing the enamel and permitting electrical contact with the copper wire. Once in position, the tabs press the wire against the central pin to ensure constant electrical contact over time.
US08475197B2
An electrical connector includes a connector housing and at least one electrical contact supported by the connector housing, the at least one electrical contact configured to mate with a complementary electrical contact of a complementary electrical connector. The electrical connector further includes a latch assembly that includes an actuator and a latch body. The actuator has an actuator portion and at least one arm extending from the actuator portion. The arm includes a proximal end connected to the actuator portion, an opposed distal end, and an intermediate portion. The intermediate portion is retained by the connector housing at a location below the distal end. The latch body is connected to the connector housing so as to rotate about a pivot axis. The latch body includes a latch member at one side of the pivot axis, and a spring disposed at a second opposite side of the pivot axis. The spring provides a spring force that biases the latch member toward a latched position. The distal end of the at least one arm is attached to the latch body at the second opposite side of the pivot axis, such that an actuation force applied to the actuator causes the latch body to pivot against the spring force so as to urge the latch member to an unlatched position.
US08475180B2
A conductive component includes a tubular body having at least one of at least one through-hole which penetrates the tubular body from outside to inside thereof; and at least one notch which is cut in from an edge of the tubular body, which are formed at least one predetermined portion on the tubular body. The tubular body includes a first portion, which includes a solder joint portion, and a second portion, which includes a contact portion. The first portion and the second portion are located on the opposite sides from one another with the at least one predetermined portion sandwiched therebetween. The tubular body further includes at least one spring portion which includes the at least one predetermined portion.
US08475178B2
An electrical connector includes a substrate, an upper plate, a lower plate, and a number of contacts. The substrate has a number of passageways. The upper plate and the lower plate are mounted upon and below the substrate, respectively. The upper plate and the lower plate both have a number of apertures corresponding to the passageways and a recess to receive the substrate. The contacts are received in the passageways and the apertures.
US08475173B2
A method of educating using a virtual workstation. The method includes the steps of: providing the virtual workstation; allowing a person to access the virtual workstation to generate multimedia product; and requiring that the person complete at least one educational project to continue accessing the virtual workstation to generate multimedia product.
US08475172B2
There is disclosed a process for motor learning, for teaching motion, or for rehabilitation of a student, the student having a motor sensory system. Plural transducers may be coupled around at least one joint of a student, the transducers for providing kinesthetic sensations to the student through its motor sensory system. Tactile control signals may be provided to control operation of the transducers to guide motions of the student.
US08475168B2
A system and method uses three-dimensional, visual feedback for simulated weapons fire during training of a soldier in a combat exercise. In the system, the soldier is provided with a weapon equipped with a laser transmitter that simulates the firing of actual rounds. Further, sensors are positioned on a human target. Also, discharge members are located on the human target. When a signal is received by a sensor, selected discharge members are activated to immediately expel a plume of dust. As a result, the plume of expelled dust provides three-dimensional, visual feedback to the soldier in real-time.
US08475167B2
A prosthetic implant is provided that has an implantable magnetic base structure that supports or couples with a prosthetic superstructure for implantation in a mammal. The implantable base more quickly fuses with surrounding tissue or bone with the aid of a magnetic field. The superstructure abuts and is supported by the implantable base, and each comprises a biocompatible magnetic material to establish a magnetic field in the region of the tissue surrounding the implantable base. An anchoring arrangement may be employed to fasten the superstructure to the base. Together, the magnetic base, superstructure, and/or anchoring arrangement are positioned relative to each other to concentrate a magnetic field in the region of the implant to facilitate fusion of the base structure with surrounding bone or tissue. Advantageously, the magnetic field shortens the healing time and retards bacterial growth to quickly fuse the base structure with the surrounding bone or tissue.
US08475166B1
An upper denture release apparatus and method of use. A denture puller has a chin rest, arm attached to the chin rest, and a hook attached to an end of the arm opposite the chin rest. An upper denture has a notch sized and located to admit the hook when a wearer's chin rests on the chin rest. The method includes the steps of resting a wearer's chin on the chin rest, inserting the hook into the upper denture notch, and opening the wearer's mouth, thus pulling the upper denture off the wearer's upper gum. Arm length adjustment is shown, whereby the denture puller may be adjusted to fit differently-sized upper denture wearers. Preferred hook declination, hook toe, arm and notch floor angles are disclosed.
US08475161B2
In a high efficiency regenerator burner for heating spaces, the exhaust gas generated by the burner is provided which is conducted alternately through different regenerator cartridges and a partial stream of the exhaust gas is conducted under the control of an orifice plate through a bypass space in which the regenerator cartridges are disposed. A control structure is disposed in a burner head for controlling the exhaust gas bypass flow volume and also to control the main exhaust gas flow as well as the combustion air flow through the regenerator cartridges.
US08475157B2
An injection nozzle that can be used in an injection blow molding system without use of an external heat source comprises a two-piece structure broadly including a structural outer body for coupling the nozzle to a resin manifold and a thermally conductive insert. At least a portion of an axial length of the insert has an outer diameter that is less than an inner diameter of a coinciding coaxial portion of the outer body, such that the differences in the inner and outer diameters present an insulating air gap along at least a portion of the nozzle length. A sufficient operating temperature for hot melt resin can then be obtained without use of the external heat source.
US08475154B2
The present patent application provides a flower pot mold for blow molding. The mold can reduce the number of the sliding blocks that need to be moved, and utilize the motion of a single sliding block to mold a flower pot so as to improve the manufacturing efficiency and the product quality. The mold includes a flower pot cavity template; a container opening pulling mold; a plurality of opening flanged pulling plates, a blowing tube being disposed in the container opening pulling mold; a fixing plate configured for fixing the mold onto a clamping set; a guiding block configured for guiding the opening flanged pulling plate and a blocking plate; and the blocking plate configured for blocking the plastics. A sliding track is formed on the flower pot cavity template and configured for allowing the blocking plate to move back and forth.
US08475152B2
An apparatus for producing a three-dimensional shaped product capable of decreasing thermal dissipation due to thermal conduction of a heating device or a cooling device loading a base plate, in which powder is sequentially sintered on a table and a base plate inside a shaping tank, wherein a space of vertical direction is formed on the table or the space is formed and a heat insulating material is filled into the thus formed region, a heating device or a cooling device which loads the base plate supporting the sintered layer is firmly fixed.
US08475151B2
A compressor is provided with a substantially cylindrical housing. Inside the housing is a motor housing having a substantially cylindrical shape and a compressor housing having a substantially cylindrical shape. The motor housing and the compressor housing are connected or fit into the housing with a frictional connection to prevent axial movement of the motor housing and the compressor housing.
US08475144B2
A micropump device including a first wafer and a second wafer attached to the first wafer. The first and second wafers are configured to define a chamber therebetween having a predetermined volume. A third wafer is attached to the second wafer to define an inlet section and an outlet section in fluid communication with the chamber. At least one of the second and third wafers are formed to define a moveable diaphragm configured to change the predetermined volume of the chamber for pumping a fluid between the inlet section and the outlet section.
US08475137B2
In an electric-motor-driven oil pump unit with automatic engine-stop system interaction, in which an electric-motor-driven oil pump is driven by an electric motor for hydraulic pressure supply to a transmission of an automotive vehicle employing an automatic engine-stop system, at least in a stopped state of a mechanical oil pump driven by the engine, a motor current/speed detector is provided for detecting a motor current and/or a motor speed of the electric motor. Also provided is a controller configured to output an inhibiting signal to the automatic engine-stop system for inhibiting a mode shift to an automatic engine-stop mode, when a change in the motor current and/or the motor speed during a preliminary operation of the electric-motor-driven oil pump executed from a point of time when an automatic engine-stop condition of the vehicle becomes satisfied, is out of a specified characteristic.
US08475135B2
A wind turbine blade is provided with an outer skin layer formed of fiber-reinforced plastic, and a plurality of main structural members formed of fiber-reinforced plastic integrally with the outer skin layer to extend in a blade length direction. The main structural members include a plurality of main dorsal structural members positioned on a dorsal side of the wind turbine blade, and a plurality of main ventral structural members positioned on a ventral side of the wind turbine blade.
US08475131B2
A centrifugal compressor provided with an impeller which is configured to have a plurality of blades arranged at a predetermined interval in a circumferential direction of a hub rotating together with a rotation shaft, in which a blade angle on a shroud side of the blade distributes to have a minimum value at a position between a leading edge of the blade and a midpoint of a camber line on the shroud side, and a maximum value at a position between the midpoint of the camber line on the shroud side and a trailing edge of the blade, and a blade angle of the blade on a hub side distributes so as to have a maximum value at a position between a leading edge and a midpoint of a camber line on the hub side.
US08475126B2
A housing assembly for a fan unit includes an upper housing having a lower engaging portion adjacent to its lower end surface and a lower housing having an upper engaging portion adjacent to its upper end surface. When one of the upper and lower housings rotates relative to the other about a center axis of the housings in a first direction with the opposing end surfaces of the housings in axial contact, the lower and upper engaging portions engage with each other. While the lower and upper engaging portions are in engagement, one of the lower and upper engaging portions presses the other in both axial directions to cause elastic axial deformation of the other; and one of the lower and upper engaging portions presses the other toward both the first direction and a second direction opposite thereto to cause elastic circumferential deformation of the other.
US08475123B2
A fan housing structure including a base seat and a sideboard. The base seat has a bed section and a mating section extending along a periphery of the bed section. The bed section has a bush made of a material other than the material of the bed section. The bush is disposed on the bed section to axially protrude therefrom. The sideboard is made of a material other than the material of the base seat. The sideboard is disposed on the mating section and integrally connected with the base seat. The sideboard and the base seat together define a space therebetween. The sideboard and the bush are made of a material other than the material of the base seat and are integrally connected with the base seat by means of insert injection molding. Accordingly, the fan housing structure has enhanced structural strength and thinner thickness to save room.
US08475119B2
An airflow shielding device is configured for being secured to fan and includes a first member, a second member, and a plurality of shielding pieces. The first member defines a first through opening. The second member defines a second through opening corresponding to the first through opening. The shielding pieces are rotatably secured between the first member and the second member and rotate between a closed position, where the shielding pieces cover the first through opening, and an open position, where the shielding pieces are located so that air can flow through the first and second through openings.
US08475107B2
A paper-sheet handling device relating to the present invention has a configuration such that a binder paper alignment unit for temporarily reserving a plurality of paper-sheets perforated at predetermined positions, a movement mechanism for binding the bundle of paper-sheets thus aligned owing to the above by means of a binding component, and a binder cassette for storing the binding components for being transferred thereto, wherein the movement mechanism is arranged on the downstream side of the binder paper alignment unit and the binder cassette and also, the binder paper alignment unit and the binder cassette are arranges radially on the upstream side to form an approximately V-shape by making the aforesaid movement mechanism to be a reference. It is possible depending on this configuration to concentrate the necessary constructional elements at the periphery of the movement mechanism, so that the arrangement of the component members in the horizontal direction of the device can be restricted and the aforesaid device can be miniaturized.
US08475105B2
A binding system for binding a stack of sheets with a binding element includes a binding machine having an indicia associated with an operation to be performed in binding the stack of sheets, and at least one binding element having an indicia corresponding to the indicia on the binding machine.
US08475104B2
A production line including a casing-in machine and a processing section upstream of the casing-in machine. The processing section includes processing stations arranged at clocking intervals along the processing section to process a book block spine. The processing section includes a first processing station group and a second processing station group. The production line further includes a conveyor to successively supply the book blocks in clocked operation to the processing stations. The conveyor includes a first conveying section assigned to the first processing station group, the first conveying section including a first individual drive, and a second conveying section assigned to the second processing station group, the second conveying section including a second individual drive. The production line further includes a control unit operatively connected to the first individual drive and second individual drive to change the clocking interval length along the processing section.
US08475103B2
A sealing washer assembly includes a main washer with a bottom annular groove for a removable O-ring and a top recess for a sealing washer. A fastener such as a screw or bolt passes through the sealing washer and the main washer, into a hole in a mounting surface. When the fastener is tightened, the main washer is clamped to the mounting surface to create a metal-to-metal seal, the O-ring is deformed to create a seal between the main washer and the mounting surface, and the sealing washer is deformed to create a seal between the fastener and the main washer.
US08475102B2
A sleeve interference fastener adapted to be installed in a hole of a structure includes a sleeve; a pin member, wherein the pin member has a transition zone between a shank portion and a locking portion and wherein a portion of the pin member comprises a low friction dielectric coating; a locking member; wherein, in the installed position, a first interface between the shank portion of the pin member and the sleeve is substantially free from the low friction dielectric coating, and wherein, in the installed position, the transition zone of the pin member and a second interface between the locking portion of the pin member and the locking member are substantially covered with the low friction dielectric coating.
US08475101B2
A locking screw for connecting two or more articles together is provided. The screw includes an externally threaded shaft, a head, and an elastic member. The head defines a chamber in which a spiral groove is defined. The shaft extends from the bottom of the chamber; and the elastic member is arranged around the shaft and one end of the elastic member is received in the spiral groove of the chamber and another end abuts against an article. The elastic member can be rotated around the longitudinal axis of the shaft, to change the length of the elastic member, so that enough tension is created to ensure locking the screw in place and prevent any rotation, thus maintain a tight engagement among the articles.
US08475099B2
A fastener device includes a self-clinching retainer and a blind fastener. The self-clinching retainer is mounted to a hole in a sheet. The blind fastener is at least partially floating within the self-clinching retainer. The blind fastener has blind thread so that any debris from engaging another fastener is captured within the blind fastener.
US08475098B2
Systems, apparatus and methods for an accessory retaining device are described. According to various embodiments, a handle, shaft and fastener are configured to provide a rotational interface. With the assistance of a cam bushing, threading between the shaft and the fastener or other components, rotation of the handle causes axial movement of the shaft or fastener and compression of a grommet located about the shaft or fastener. Compression of the grommet results in radial expansion. In this way, the accessory retaining device is adapted to secure an accessory to a mounting aperture located on a vehicle or other device when the handle is in a closed position. Other embodiments are described and claimed.
US08475079B2
A drainage apparatus comprises a support device including a support segment defining a clamp path, a first clamp member and a second clamp member. At least the second clamp member is configured to be coupled to the support segment while being free to translate along the clamp path. The drainage apparatus further includes a wedge including a drive axis, a first edge and a second edge. The wedge is tapered along the drive axis between the first edge and the second edge, and the wedge is configured to be driven in a direction of the drive axis into a locked orientation of the support device.
US08475078B2
Embodiments disclosed herein relate to systems, methods and devices for containing a substance within a region. In some embodiments, one or more hollow structures are positioned around the region and the structures are at least partly filled (e.g., through fill openings) with a weighting material. Some embodiments relate to a curved device comprising steps, such that a first cross-section of the device comprises a round shape and a second cross-section comprises a plurality of substantially linear segments. Some embodiments relate to a tank connection device comprising a sleeve extending through a curved device.
US08475076B2
A socket wrench in which a supporting hole is formed in a drive disposed at an operating handle, and a steel ball pressed by a coiled spring is movably engaged with the supporting hole. A recess part for allowing the steel ball to partly engage therein is formed in an inner wall of an assembling hole of a wrench body for allowing the drive to engage therein. A connecting hole engageable with a polygonal head part of a bolt to be operated is formed in the wrench body in such a manner as to be coaxial with the drive. The recess part has a pair of contacting walls for the steel ball to contact therewith, the pair of contacting walls being disposed in mutually intersecting directions.
US08475074B1
In some embodiments, a variable stiffness joint is provided which has a plurality of structural members with a variable stiffness material coupled between the plurality of structural members. The variable stiffness material may be selectively activated/inactivated to control the stiffness of the joint. Additional embodiments and implementations are disclosed.
US08475069B2
In a portable small size printer unit 1, when a pickup roller is replaced, user grips a roller main body and slides it resisting a bias force of a spring. Consequently, when the roller main body is slid, the entire length of the pickup roller is shortened, so that a first convex portion is removed from a first concave portion. After that, the front end of a slide shaft member is removed from a shaft mounting portion by tilting the roller main body and then, the pickup roller is removed from the printing mechanism unit. By sliding the slide shaft member outward of the roller main body, the roller main body is taken out of the slide shaft member and the like so as to replace only the roller main body.
US08475063B1
A lens cap includes a ring detachably mounted onto a lens of an optical apparatus and a pair of linkage sets pivotally connected to the ring, wherein the two linkage sets are diametrically corresponding to each other and respectively connected to a covering structure. A sleeve is longitudinally and slidably sleeved on the ring and the covering structure is connected to sleeve. As a result, the covering structure selectively opens/closes the sleeve when the sleeve is reciprocally moved relative to the ring. The covering structure and the sleeve are used as a lens cap when the covering structure closing the sleeve, and used as a lens hood when the covering structure is opened.
US08475061B2
Membrane suspended optical elements include a structured substrate including a plurality of apertures defined therein and an array of optical elements, each of the optical elements being suspended by membrane within one of the apertures.
US08475053B2
A first fit portion and a second fit portion of an inner ring according to the invention have a spring property. Therefore, the first and second fit portions may be flexed radially outward by elasticity thereof and then fitted to a shaft. Thus, the inner ring is tightly fitted to the shaft with a set interference with respect to the shaft. Accordingly, it is easy to fit/remove the inner ring to/from the shaft. Therefore, an outer peripheral face of the shaft is pushed radially inward by elasticity of the first and second fit portions, that is, the inner ring is tightly fitted to the shaft, without reducing the ease of fitting/removing the inner ring to/from the shaft. As a result, it is possible to minimize generation of creep.
US08475046B2
A polymeric woven bag has a first panel and a second panel and an open end of the bag to be pinched closed. A first layer of heat activated adhesive material is on a portion of the bag to form an adhesive-to-adhesive seal by contact with a second layer of heat activated adhesive material on a portion of the bag. second panel, wherein the first adhesive layer and the second adhesive layer have respective heat activation temperatures below the softening point temperature of the polymeric bag material, and wherein sealing the bag end after the bag has been filled with contents by heat activating the first layer of adhesive material and the second layer of adhesive material at a temperature below the softening point temperature of the polymeric bag material.
US08475041B2
An X-ray diagnostic apparatus includes imaging means including an X-ray application unit which applies X-rays to a subject and an X-ray detection unit which detects the X-rays applied from the X-ray application unit to pick up a medical image, path calculating means for obtaining a path of an imaging position for the subject on the basis of a map image, a storage unit which stores the path, imaging system moving means for movably supporting the imaging means to capture the imaging position in an imaging field and movement control means for moving the imaging system moving means to successively move the imaging position along the path.
US08475037B2
A moving object thermometer is provided which can precisely measure the surface temperature of a moving (travelling) measurement object, particularly, a small-diameter conductive wire. A first metallic wire 1 and a second metallic wire 2 constituting a thermocouple are disposed on the outer circumferential surface 13 of the disk 11 in the rotary section 10 so as to be inclined toward the shaft center. A thermoelectric force resulting from contact of the metallic wires with a measurement object is converted into an electric signal, which is transmitted through the light emitting diode 31 and passed to the photodiode 32 provided at the stationary section 20 in a non-contact manner. Application of a high frequency current to the stationary side coil 42 provided at the stationary section 20 causes electric power to be supplied in a non-contact manner to the rotary side coil 41 provided so as to be opposed to the stationary side coil 42.
US08475031B1
LED backlight module structure for increasing process yield comprises a housing, a copper circuit layer, a plurality of LED chips, a plurality of solder paste overflow prevention members, a light guide plate, and a bottom reflector. In the present invention, it mainly disposed the solder paste overflow prevention members between the LED chips and the copper circuit layer, therefore, the solder paste overflow phenomenon is prevented when using a pressing fixture to assist in executing the welding process of LED chips, and it ensures that the soldering pins of the LED chips would not electrically connect to each other due to the solder paste overflow phenomenon. Moreover, a position limiting band can be further disposed on the copper circuit layer for receiving and fixing the LED chips, in addition, the position limiting band is helpful to the LED chips in heat dissipation when the LED chips emit light.
US08475024B2
A photoluminescent track for an emergency lighting system comprises an elongate holder and an elongate photoluminescent insert received in a channel extending lengthwise of the holder. The insert is a push-fit in the channel and is retained by engagement of opposed inwardly directed lips at the mouth of the channel with the upper side edges of the insert so that the upper surface of the insert is exposed within the opening.
US08475008B2
The invention relates to a lighting unit (1) having a concave reflector (2) with an axis of symmetry (3) and a light emission window 21) bounded by a circumferential edge (20) transverse to the axis, an elongate light source (30) extending substantially along the axis of symmetry (3), which light source (30) is accommodated in a holder (4) opposite the light emission window (21), and an axially positioned cap (5), which cap partly surrounds the light source (30) and forms an optical screening means to intercept unreflected light rays. According to the invention, the cap (5) forms part of a sleeve (60) surrounding the light source (30).
US08475005B2
A backlight unit of an embodiment includes: a light emitting module including a plurality of light emitting diodes and a module substrate on which the light emitting diodes are mounted; a bottom cover accommodating the light emitting module; a board on the bottom cover; a transformer mounted on a lower portion of the board, and including a core and a coil surrounding at least one portion of the core; a transformer cover covering the transformer; and a heat dissipating cover between the transformer cover and the bottom cover.
US08475003B2
Substantially cylindrical supporting units are formed at both sides of a lens. The supporting units are to adjust the separation distance between the lens and the surface of a substrate depending on the height dimension of a light emitting diode mounted on the substrate from the substrate face when the lens body is fixed to the substrate. A cylindrical convex part is formed at a part of the tip face of the supporting unit in a concentric fashion relative to the supporting unit, and a cylindrical positioning unit is formed at a part of the tip face of the convex part in a concentric fashion. The positioning unit functions as a member for positioning when the substrate and the lens body are fixed to each other.
US08474999B2
A light emitting diode (LED) lamp includes a lamp holder, an optical module, a thermal pad, and a fixing ring. The lamp holder has a first recess in which the optical module is configured. The thermal pad is configured in the first recess and between the optical module and the lamp holder, so as to separate the optical module from the lamp holder. The fixing ring is locked to the lamp holder, so as to fix the optical module into the lamp holder. The optical module includes a first fixing element, an LED board, and a lens. The first fixing element has an accommodating opening in which the LED board is configured. The LED board includes a circuit board and LEDs, and the LEDs are configured on the circuit board. The lens is fixed to the first fixing element and covers the LEDs.
US08474995B2
A clip light includes a light head including a light housing having a light window, and a LED light source supported in the light housing to align with the light window; a power source supported in the light housing; and a mounting arrangement which includes a clipping unit pivotally coupling with the light housing, wherein the light housing is selectively moved to adjust a light projecting orientation of the light source via the clipping unit when the clipping unit is coupled at the desired object.
US08474989B1
A target system and method for photogrammetry using a target holder with an aperture at least partially therethrough to precisely position a target assembly therein for use in determining geometric properties of an object.
US08474988B2
A projector to which a ceiling suspension attachment is fixed. The projector accommodates an internal device. The projector is provided with an outer case including a bottom wall that defines an outer bottom surface and an inner bottom surface of the outer case. Insert nuts are arranged on the bottom wall. Each insert nut includes a threaded hole to which a first coupling screw is fastened and a second coupling screw can be fastened. The first coupling screw couples the attachment to the outer bottom surface of the bottom wall, and the second coupling screw is fastened to the threaded hole from a side opposite to the first coupling screw. The second coupling screw is fastened at least one of the insert nuts to couple the inner device to the inner bottom surface of the bottom wall.
US08474986B2
A drive, primarily for an optical light forming device, which light forming device can be used in a projector, which light forming device comprises an at least partly open area for light, where at least two light forming devices cooperate in a light path for forming the light, which light forming devices are rotated around a common axis in and out of the light path. To achieve opposite synchronous movement of light forming means, the light forming devices are rotated equal in opposite directions around the common axis by a common motor. Hereby, it can be achieved that the two light forming devices are rotated synchronously, but opposite in relation to each other. The opposite synchronous movement is very important if the light fainting devices are part of a modern computer controlled projector using step motors.
US08474983B2
A light-source cooling device is provided that, without adopting a complex configuration, is capable of reducing the temperature difference between the top portion and bottom portion of a light source despite change of the installation orientation. The light-source cooling device of the present invention for cooling a light source (11) is provided with: two ventilation ducts (4and 5) for guiding cooling airflows (13a and 13b) to strike against the light source (11) from opposite directions, and two fans (2and 3) for impelling the cooling airflows (13a and 13b) to two airflow guide units (4and 5).
US08474976B2
A pair of spectacles that can automatically change its power so that a fixation region of interest (ROI) of the user is always in focus. The automatic accommodative spectacle device includes focusing elements, sensors, line of sight detector, focus engine, focusing element controller, and power supply. The line of sight detector determines the line of sight for the left and right eyes of the user using data from the sensors. The focus engine uses the lines of sight for left and right eyes to determine the user's fixation ROI. The fixation ROI is used to determine powers for the focusing elements in order to bring the fixation ROI into focus. The focusing element controller carries out the needed optical power adjustment to apply to the focusing elements. Optional light sources may be provided.
US08474950B2
The recording apparatus includes a conveyor and a recording head which records an image to a recording medium being conveyed by the conveyor. The conveyor includes a circumferential wall, and conveys a recording medium placed on an outer circumferential surface of the circumferential wall, by rotation of the circumferential wall. The recording head includes an ejection surface where a plurality of nozzles are open, which nozzles eject at least one liquid droplet. The circumferential wall includes a tube-shaped base, and one or more detachable plates detachably attached to an external surface of the base.
US08474945B2
A method of operating an inkjet printer including an inkjet printhead having an ink inlet, the inkjet printhead mounted on a motor-driven carriage having an encoder sensor, the method including sending a signal from the encoder sensor to a controller to indicate a position of the motor-driven carriage; determining a velocity of the motor-driven carriage; implementing a first motion control mode during a period when the inkjet printhead is printing, wherein the first motion control mode includes a first signal for damping vibrations in order to provide a substantially constant velocity of the carriage; selectively implementing a second motion control mode when the inkjet printhead is not printing, wherein the second motion control mode includes a second signal for enhancing vibrations of the carriage in order to dislodge air bubbles in the printhead; and removing air corresponding to the air bubbles from the printhead.
US08474939B2
The information expressed by an original color image can be visually recognized even if the recording medium on which the color image has been recorded in dye ink is wetted with water. With a printing device equipped with pigment ink and dye ink, in the printing of a color image, the pigment ink corresponding to an image characteristic amount included in the color image is also injected along with the dye ink, so an image expressing the image characteristic amount included in the color image is recorded with the pigment ink, which has excellent water resistance, over the color image printed with the dye ink on the printing medium. Accordingly, in the event that the recording medium becomes wet and the dye ink bleed, the user can still make out the content of the information expressed by the original color image from the image printed in the pigment ink.
US08474932B2
An image forming apparatus includes a head tank and a main tank that sends liquid to the head tank. When the remaining ink amount in the main tank is less than or equal to a predetermined amount (near empty), the liquid sending amount to be sent from the main tank to the head tank required for detecting a full state of the head tank is set to be a second liquid sending amount which is greater than a usual first liquid sending amount. An ink supply operation is performed to send liquid corresponding to the second liquid sending amount, from the main tank to the head tank. Then, it is determined whether the head tank is in a full state. When the head tank is not in a full state, the main tank is determined to be in an ink empty state.
US08474931B2
This invention is directed to a system for stirring pigment ink whose pigment particles in a container subside without moving the container containing pigment ink, and detecting that pigment particles have been stirred satisfactorily. To achieve this, a pair of electrodes greatly different in surface area and at least one of which has an inconstant width are arranged outside a container containing pigment ink whose pigment particles subside. An AC power supply is connected to the electrodes and applies an AC voltage to them. Then, an electric field generated between the electrodes causes induced polarization in pigment particles which subside in the container. The pigment particles are attracted to a portion having high electric field intensity. Convection occurs in the container, stirring the subsiding pigment particles. Based on a voltage detected by an interelectrode voltage detector, it is detected that pigment particles are dispersed sufficiently.
US08474923B2
Gun safes according to various embodiments include a secure housing and a rotatable gun support assembly that is disposed at least partially within an interior portion of the secure housing, and that is adapted to support rifles in a substantially upright position adjacent a perimeter of a portion of the gun support assembly.
US08474921B2
A support apparatus includes a patient assist bar that is coupled to a wall or to some other structure in a room of a healthcare facility, such as a headwall that is configured to be coupled to the room wall. The patient assist bar is pivotable a first axis that is substantially vertical and parallel to the headwall and a second axis that is substantially horizontal. The patient assist bar provides the patient with a stable support and guidance in moving about the room.
US08474920B2
A protective cap is installed in a wheel hub to protect a wheel speed sensor and bearing assembly from intrusion of dirt. The hub has inner and outer end faces, and a central bore having splines for engagement by a splined driveshaft. The speed sensor system has a segmented disc rotating with the hub and a sensor mounted on a housing and extending into proximity with the segmented disc. The protective cap includes a stem for insertion through the central bore and a head having an under face for engaging with the inner end face of the hub. The head has a distal rim portion overlapping the housing to allow rotation of the protective cap relative the housing to prevent entry of dirt to the speed sensor system and bearing. The stem has yieldable retainers for engaging with the outer end face of the hub to retain the protective cap.
US08474917B2
A seat assembly having a seat and a seat back that is pivotally connected to the seat. A back cover is disposed on a rear portion of the seat back. The back cover includes an interior side and an exterior side. The interior side includes a plurality of laterally-extending ribs aligned with a plurality of engagement members. At least one vertically-extending channel is disposed on the exterior side of the back cover.
US08474912B2
Subject matter described herein includes a seat assembly (e.g., chair, bench, sofa, vehicle seat, etc.) having a seat and a back rest that adjust together to facilitate reclining. The seat assembly includes a base coupled to a back-rest frame. The base remains substantially fixed relative to synchronized adjustment of the seat and the back rest, and the back-rest frame includes a pivot on which the back rest rotates to adjust a back-rest recline position. The assembly also includes the seat hingedly coupled to the back rest and a fore-and-aft adjuster that couples the seat to the base. A movement restrictor attaches to the seat and the base and biases the seat in a rearward orientation. The assembly further includes a pivot receiver coupled to the back rest, the pivot receiver providing a path along which the pivot travels when the seat moves forward and rearward.
US08474909B2
A power lift lumbar support system for a furniture member includes a lumbar pad. A scissoring portion is rotatably connected to the lumbar pad and moves the lumbar pad between a fully retracted and a fully extended position. A lumbar actuation portion is connected to the scissoring portion and drives the scissoring portion using a powered actuator to displace the lumbar pad. A carrier support rod has first and second carriers slidably disposed on the carrier support rod. The scissoring portion is connected to each of the first and second carriers. Displacement of the first and second carriers toward each other operates through the scissoring portion to displace the lumbar pad away from the carrier support rod and toward the fully extended position.
US08474908B2
Disclosed is a seat element (1) for a seat system, which extends substantially across an entire zone of a backrest and/or a seat area of a seat in a mounted state. Said seat element (1) comprises devices (12-21) for receiving functional elements in order to provide additional seat functions. Such a modular seat system makes it possible to create in a simple manner different fittings of a seat, especially a vehicle seat.
US08474907B2
A car seat has a base for placement on a vehicle seat and a seat shell attachable to and detachable from the base. A latch mechanism is biased to a latched arrangement attaching the shell to the base. A release actuator is connected to the latch mechanism and can move the latch mechanism to a released arrangement, detaching the shell from the base permitting its removal from the base. The shell can be optionally adjustable on the base between at least two different recline positions. The latch mechanism in the latched arrangement can then also retain the shell in one of the recline positions. A recline actuator can be connected to the latch mechanism and can move the latch mechanism allowing adjustment of the shell recline position but not permitting removal from the base.
US08474906B2
A roof apparatus includes a functional bracket supporting a movable panel, a guide rail, a drive shoe moving along the guide rail, a front link connected to the functional bracket to move in conjunction with the movement of the drive shoe, a rear link connected with the drive shoe to support the functional bracket, front and rear restriction portions arranged at the front link, front and rear restriction portions arranged at the rear link, a first distance defined between the front restriction portion of the front link and the rear restriction portion of the rear link, and a second distance defined between the rear restriction portion of the front link and the rear restriction portion of the rear link, wherein the front link and the rear link are arranged at different positions on a plain surface extending in a direction perpendicular to a direction in which the guide rail extends.
US08474899B2
A retractable top is disclosed for off-road vehicle such as Jeep® Wrangler® and CJ® brand vehicles. The top includes a frame and a fabric cover designed to cover and move with the frame. The frame includes a base plate that is secured to the belt rail surrounding the rear compartment of the vehicle. The top is deployable between a stowed configuration folded upon itself over the rear compartment of a vehicle and a deployed configuration covering the passenger and rear compartments of the vehicle. During deployment, the top unfolds in a substantially vertical direction over the rear compartment substantially to its full extent. This avoids collision with the rear doors and roll bars of the vehicle. Once so deployed, the entire top pivots downwardly into place covering the passenger and rear compartments of the vehicle.
US08474894B2
A moveable bulkhead 10, 110 for a motor vehicle such as a van 1 is disclosed comprising of a number of panels 11, 12, 13; 111, 112, and 113 hingedly connected together to permit the bulkhead 10 to be moved or transformed between forward and rear positions by rotation of the panels 11, 12, 13; 111, 112, and 113. The bulkhead 10 is “U”-shaped defining a concavity that faces forward when the bulkhead 10 is latched in the forward position and rearwardly when the bulkhead 10 is latched in the rear position so as to maximize the cargo carrying capacity of the van 1.
US08474887B2
A door opening and closing apparatus for a vehicle includes a displacement body operating a latch and being displaced within a moving region including a closing region, a releasing region and a neutral region positioned between the closing region and the releasing region, the displacement body displacing by an actuator, a control unit controlling the actuator for selectively engaging and disengaging the latch and a striker, a first detection portion outputting a first detection signal changed when the displacement body passes through a first border portion of the neutral region closer to the closing region, and a second detection portion outputting a second detection signal changed when the displacement body passes through a second border portion of the neutral region closer to the releasing region. The control unit controls a moving position of the displacement body based on the first detection signal and the second detection signal.
US08474882B2
A sliding mechanism for portable electronic device includes a sliding housing, a main housing and a stopping module. The sliding housing includes two ledges. At least one of the ledges defines a first notch and a second notch. The main housing includes two rails and at least one elastic member. The sliding housing is slidingly attached to the main housing by engagement of the ledges and the rails. The at least one elastic member includes a positioning portion. The positioning portion flexibly resists the at least one of the ledges and is selectively engaged in the first notch and the second notch. The stopping module prevents the sliding housing from separating from the main housing.
US08474873B2
A seat belt system in motor vehicles includes a seat belt disposed at a front seat and a shoulder-belt portion and a lap-belt portion, which at its outer anchorage point, is retained in the area of a door sill of the motor vehicle on a belt tensioner that is connected to the lap-belt portion via a connecting device. The connecting device is disposed out of view below a door-sill molding.
US08474872B2
There is provided a passive safety device which can prevent an occupant from moving when an acceleration that causes the occupant to move in a vehicle is working on the occupant, and which can improve the ride comfort. A passive safety device of the present invention comprises an acceleration detecting unit that detects an acceleration of a vehicle, a seat adjusting unit that expands a seat side of a seat in order to prevent an occupant sitting down the seat from moving, a safety belt adjusting unit that controls tension of a safety belt worn by the occupant, and a control unit that controls an expansion of the seat side and/or the tension of the safety belt through the seat adjusting unit and the safety belt adjusting unit, based on the detected acceleration of the vehicle.
US08474871B1
A frame for recreational vehicles having a pair of oppositely spaced longitudinal frame members, having notches completely therethrough. The longitudinal frame members have a foam core in direct contact with a woven fiber fabric on an exterior of the longitudinal frame members with fabric flaps extending therefrom. The frame has a plurality of transverse stringers having a foam core in direct contact with a woven fiber fabric on an exterior of stringers that rest in notches of the longitudinal members. The stringers are complementary to the notches in the longitudinal members and the stringers have fabric flaps that extend along their length on opposite sides. The stringers extend completely through the longitudinal frame members. The flaps on the longitudinal frame members and the stringers are in overlapping contact. A deck having a layer of fabric covers the stringers, the flaps, and the longitudinal frame members and is impregnated with resin.
US08474863B2
A side airbag system is provided with a side airbag for protecting the upper thorax and head area of a vehicle passenger between a lateral vehicle structure and the vehicle passenger, and with a gas generator that is fluidically connected with the side airbag. The side airbag is planar in the deployed condition, and protectively covers a path of motion for the head, along with various seated positions for small and large vehicle passengers. In order to realize an expanded protective potential for the head in semi-convertibles and compact cars, the side airbag, viewed from the lateral vehicle structure, has an outer contour with an essentially continuous bead.
US08474857B2
An airbag device for a saddle-ride type vehicle can include an acceleration sensor for detecting impacts working on a body to actuate the airbag, a left-right pair of acceleration sensors in side frame members.
US08474854B2
A foldable stroller has a frame assembly with a frame fold joint and is reconfigurable between an in-use configuration and a folded configuration. A child support structure is repositionable between a usable state on the frame assembly in the in-use configuration and an unusable state not suitable to support a child on the frame assembly. An interlock mechanism cooperates with the child support structure and is movable between a locked state preventing the frame assembly from being folded from the in-use configuration to the folded configuration and an unlocked state permitting the frame assembly to be folded. With the frame assembly in the in-use configuration and the child support structure on the frame assembly in the usable state, the interlock mechanism is retained in the locked state. The interlock mechanism is unlocked when the child support structure is moved to the unusable state.
US08474851B2
A suspended rider bicycle has a suspension boom which extends from the frame above the rider's torso, and a suspension device such as a belt or sling for suspending the rider's torso from the suspension boom.
US08474849B2
A powered wheelchair includes a seat assembly configured to support an individual, a curved legrest assembly pivotally connected to the seat assembly, and an adjustment assembly including an actuator operatively connected to the central column through a piston slidably secured within a sleeve. The adjustment assembly is secured underneath the seat assembly. The powered wheelchair may also include an extension bracket that allows legrests and a central column of the curved legrest assembly to be separately and independently adjusted with respect to one another.
US08474844B2
A suspension structure is a double wishbone type suspension including a spring damper and is characterized in that, among a plurality of mounting points where an upper arm and a lower arm arranged vertically parallel to each other are connected to a vehicle body, the vertical positions of the mounting points, which are located on the left or right side with respect to a hub assembly, of the upper arm and the lower arm are different from each other.
US08474842B2
There are provided left and right arm mechanisms that connect an arm attachment portion as a part of a vehicle body to vehicle wheel attachment portions attached with front wheels via a front arm and a rear arm disposed in a front-rear direction of a vehicle and having plural links; and servo motors that independently drive the left and right arm mechanisms so that each link angle corresponding to a turning angle is determined. The setting position of the imaginary kingpin axis may be changed. Each link angle changes within a range of maintaining a correlation in which the turning angle increases in accordance with an increase in the steering operation amount when controlling the servo motors so as to obtain the turning angle corresponding to the steering operation amount of a steering wheel.
US08474834B2
A voter cart capable of supporting a voting terminal in a portable, fully usable, and secure configuration. The cart is generally formed with a pair of opposing side rails joined together in a spaced-apart configuration and mounted on casters, and a voting terminal housing interspaced between the side rails. The voting terminal is seated atop a bottom shelf of the voting terminal housing at waist-level for easy wheelchair voter access thereto. The voting terminal is restrained against lateral and vertical motion, and yet there is full access to the voting terminal's control panels, doors, etc. Moreover, the particular design maximizes strength and usability, and yet keeps weight to a minimum with a framework that is as light weight as possible.
US08474832B2
A mobile device holder includes a lower holding portion having a pair of opposed lower holding portion channels, a shelf at the base of the lower holding portion, an upper holding portion having a pair of opposed upper holding portion channels, the pair of opposed upper holding portion channels diverging in a direction away from the lower holding portion and aligned with the pair of opposed lower holding portion channels, the upper holding portion affixed to the lower holding portion, and a base connected to the shelf of the lower holding portion.
US08474829B2
To prevent breakage of a sealing device having a main sealing body installed within an annular installing groove (31) formed in one member (3) to slidably and concentrically contact with the other member (2) and a backup ring (12) arranged at a non-sealing space side of said main sealing body, a height (h1±Δh1) of said backup ring (12) in a facing direction of a bottom surface (31a) of said installing groove (31) to the other member (2) is greater than a facing distance (L±ΔL) between the bottom surface (31a) and the other member (2), and said backup ring (12) has a cross-sectional shape which is symmetrical in a thickness direction thereof, and has an easily compressible part (12a) which can be compressed to the extent of the difference (x) between said height (h1±Δh1) and said facing distance (L±ΔL).
US08474826B2
A hydrodynamic magnetic seal includes a magnetic mating ring and a sealing ring attracted to the magnetic mating ring. The magnetic mating ring and/or the sealing ring include hydrodynamic grooves configured to create a separation film between the magnetic mating ring and the sealing ring to reduce friction.
US08474819B2
A method of managing a blackjack game is provided. A blackjack game bet comprising a bet against a house entity on a blackjack hand is received from a player. A pair of cards is determined for a hand for the house entity, and another pair of cards is determined for a hand for the player. The odds of the occurrence of one or more subsequent events are determined based at least in part on one or more of the pair of cards selected for the house entity's hand and one or more of the pair of cards selected for the player's hand. The odds for an additional bet are determined based at least on the determined odds for the one or more subsequent events, and the additional bet is offered to the player at the determined odds for the additional bet.
US08474818B2
Methods and system for reducing sheet skew in a sheet transport system are disclosed. A sheet transport system may include an idler wheel, a drive wheel a drive motor and an actuator. The idler wheel may have a substantially rigid outer layer. The drive wheel may have a compliant outer layer and may correspond to the idler wheel. The drive motor may be operably connected to the drive wheel and may be configured to cause the drive wheel to rotate around a shaft. The actuator may be operably connected to the drive wheel and configured to cause the drive wheel to move between a closed position and an open position. The drive wheel is configured to contact a sheet in the closed position and to not contact a sheet in the open position.
US08474817B2
A paper sheet processing apparatus capable of preventing a paper sheet from being drawn out by an unauthorized action. The bill processing device includes: an insertion slot into which a bill is inserted; a bill conveyance mechanism capable of conveying the bill having been inserted from the insertion slot; a bill reader reading the bill conveyed by the bill conveyance mechanism; an authenticity judging mechanism judging an authenticity of the bill read by the bill reader; and a pulse output part driving a motor for controlling conveyance speed of the bill by a motor of the bill conveyance mechanism. The pulse output part controls the conveyance speed by the bill conveyance mechanism after the completion of reading by the bill reader.
US08474808B2
A sheet post-processing apparatus implements a tilted edge-binding process by a movable table rectilinearly driving portion that moves a stapling unit rectilinearly via a movable table, and rotating the stapling unit to drive a staple near a sheet corner when the staple is tilted at a predetermined angle with respect to a sheet-conveying direction. The sheet post-processing apparatus includes the movable-table rotationally driving portion that rotates the movable table to cause the stapling unit to tilt at a position to drive the staple at the predetermined angle with respect to the sheet-conveying direction, and a tilt retention portion that mechanically holds the movable table to maintain the stapling unit tilted.
US08474796B2
An improved adjustable lift strut support adapted for permanent attachment to a shock tube of a vehicle's failed lift strut. It is capable of quick safe attachment to a plethora of different diameter struts. It wont damage the shock tube assembly if it is left connected to the shock tube, nor will it damage the vehicles hood or liftback when they are closed with the support connected to the shock tube.
US08474795B2
A puller is provided with a number of advantages. Pullers are described that have a high power to weight ratio, and a high power to volume ratio. Examples of pullers and pulling systems include configurations that provide high cable friction in a small device volume. Examples of pullers and pulling systems also include constant force pulling which is desirable in particular for small diameter pipe replacement. Using pullers and pulling systems as described, minimally invasive pipe replacement operations are possible. Reversible pullers are also provided that decrease the amount of time needed to burst or split multiple segments of pipe.
US08474789B2
A magnetic sensing surface of a stroke sensor is placed in an angular range between a first imaginary line and a second imaginary line. The first imaginary line is an imaginary line that coincides with a center line between first and second magnets of a magnetic movable body when a wastegate valve is placed to have a full close degree of the wastegate valve. The second imaginary line is an imaginary line that coincides with the center line between the first and second magnets when the wastegate valve is placed to have a half degree between the full close degree and a full open degree of the wastegate valve.
US08474778B2
The invention provides an apparatus for adjustably mounting a tablet PC, portable personal computer, or flat panel video display, which is particularly suited for use during travel and in rugged conditions. The apparatus enables stable and versatile emplacement of a tablet PC by incorporating multiple independent adjustment and attachment elements. A mounting means, such as a suction cup assembly, is attachable to various surfaces and is connected to a hanger from which cordage or straps descend to a suspended frame. The frame features clips, resilient spacers, and adjustable dimensions to securely hold any commercially available tablet PC therein. The frame may further comprise various swappable stabilizer elements to separately regulate the orientation and attachment of the tablet PC to a surface. In a preferred embodiment, the apparatus is mounted to a windshield and the frame positions the tablet PC over the center console in an automobile.
US08474771B2
A tray assembly includes an articulatable arm assembly coupled with a tray and selectively held in place by a locking mechanism (e.g., a locking gas spring). A release mechanism coupled with the tray selectively activates and deactivates the gas shock mechanism and is coaxial with and free rotating with respect to an axis of rotation of the tray. The tray may rotate between a horizontal position and a stored position substantially orthogonal to the horizontal position. The arm assembly may include at least one frictional hinge comprising a tapered pin, a tapered bushing in rotational frictional contact with the tapered pin, and an adjustment mechanism coupled to the tapered pin to provide adjustable contact force between the tapered pin and the tapered bushing.
US08474768B2
A device for supporting a part has a mounting element with a pocket-shaped receptacle and a suction element which supports the part and can be received in the pocket-shaped receptacle or removed from it and directly attached to the surface, so that in both cases the part is supported on the surface, either through the suction element and the mounting element or through the suction element only, and a width of at least a portion of the suction element is smaller than a width of the pocket-shaped receptacle of the mounting element, so that when the portion of the suction element is inserted into the pocket-shaped receptacle of the mounting element, it is compressed and thereby tightly retained in it.
US08474764B2
A lightweight three-dimensional wire structure which includes a plurality of wires that are connected to each other and intersect in the three-dimensional space to form a plurality of cells. In addition, a method for producing the three-dimensional wire structure.
US08474759B2
A method and apparatus for attaching parts. A composite male fastening component is placed through at least a first part and a second part. The composite male fastener component preferably has a threaded portion. A composite female fastener component is positioned adjacent to and surrounding the threaded portion of the male fastener component. A portion of the composite female fastener component is caused to flow around and form into the threaded portion of the composite male fastener component. The portion of the composite female fastener component that flowed around and formed into the threaded portion of the composite male fastener component is re-solidified and re-consolidated such that the composite female fastener component is securely attached to the composite male fastener component thereby joining the mating parts.
US08474757B2
Sleeper seats, wherein each comprises a head rest, a back rest, a seat pan or seat cushion, a leg rest, an ottomans and a dividers between the individual seats with the their column. The four seats are arranged in a staggered chevron formation and two columns. All the seats in each column are parallel with each other and set at a “herringbone” angle αto the column direction, in other words their central axes A make the angle αwith a longitudinal axis of the array. Each seat extends from its column side of the longitudinal axis across the axis to a small extent. Along the axis, first a seat from one column crosses the axis and then a seat from the other column crosses the axis and so on.
US08474747B2
An aircraft (1) horizontal stabilizer (2) which can vary its sweep angle (6) by rotating around an essentially vertical axis (4) with respect to the direction of flight of the aircraft (1) when the aircraft (1) is in flight at high speeds, close to the speed of sound, this axis (4) being contained in the plane of symmetry of the aforementioned aircraft (1), the aforementioned horizontal stabilizer (2) being is a single and structurally continuous component such that it does not transmit a bending moment to the fuselage (14) structure of the aircraft (1), which permits it to be of reduced weight, such that the horizontal stabilizer (2) rotates in a single way and a single direction around the axis (4) to achieve the sweep angle (6) required for high-speed flight.
US08474740B2
A bale processor apparatus has a bale chamber configured to hold a front bale in the chamber forward of a rear bale in the chamber. A disintegrator apparatus removes shredded material from the front bale and forms a front stream of shredded material moving laterally, and removes shredded material from the rear bale and forms a rear stream of shredded material. An exhaust opening in the bale chamber adjacent to the front bale is oriented such that the front stream passes laterally through the exhaust opening. A conveyor receives the rear stream and carries same forward and moves same into contact with the front stream such that the rear stream is carried out through the exhaust opening with the front stream.
US08474727B2
An air conditioner and a method for controlling the air conditioner are provided. The air conditioner may include an air-conditioning device having a variety of components that provide air-conditioning of an indoor space, an input device that receives signals to manipulate the air-conditioning device and signals to select a sleep mode, and a controller that, when the input device receives a signal to select the sleep mode, controls the air-conditioning device to perform a rapid eye movement sleep operation at least one time to air-condition the indoor space at a temperature higher than a temperature that is set in accordance with the sleep mode.
US08474711B2
An interactive shopping system, apparatus and methods are provided for use at a brick-and-mortar merchant location. The interactive shopping system includes a basket for holding items selected by a shopper, and a unique identifier for the basket. An input device is associated with said basket to obtain information regarding specific items as they are placed in the basket. A point of sale system is associated with the input device to collect information obtained from the input device, associate that information with the unique identifier for the basket, and complete a purchase transaction for all items located in the basket at checkout.
US08474709B2
An automated banking machine operates responsive to data bearing records to carry out financial transactions. The machine includes a card reader that operates to read data from user cards that corresponds to financial accounts. The machine also includes a display, at least one manual input device, a cash dispenser, and a machine computer that operates to cause financial transactions to be carried out on financial accounts that correspond to data read from cards. The machine computer is also operative to cause digital information to be sent from the machine to a machine user's remote system address.
US08474705B2
An automated banking machine operates responsive to data read from data bearing records, such as user cards, to cause machine user authorization and financial transfers. Account data read from a user card is associated in a data store with instructions for displaying a customer interface uniquely associated with the particular bank where the user holds the account. The customer interface includes user-selectable financial transaction options. The arrangement enables the customer interface of the user's home bank, with which the user is familiar, to also be automatically displayed when the user operates automated banking machines of other banks.
US08474703B1
An automated banking machine is part of a banking system that can operate to cause financial transfers responsive to data read from data bearing records, including user cards. The machine is in operative connection with a system operable to capture images related to activity that is conducted at or adjacent to the machine. The machine is positioned at a banking facility having a vault and an entrance. A plurality of cameras are positioned at the facility. Captured images can be analyzed at a remote monitoring center. The monitoring center can operate to assure that employees or customers of the banking facility can safely enter and/or exit the banking facility.
US08474700B1
A banking system operates responsive to data read from data bearing records. The system includes an automated banking machine comprising a card reader. The card reader includes a movable read head that can read card data along a magnetic stripe of a card that was inserted long-edge first. The card reader includes a card entry gate. The gate is opened for a card that is determined to be properly oriented for data reading. The card reader can encrypt card data, including account data. The machine also includes a PIN keypad. The card reader can send encrypted card data to the keypad. The keypad can decipher the encrypted card data. The keypad can encrypt both deciphered card data and a received user PIN. The card data and the PIN are usable by the machine to authorize a user to carry out a financial transfer involving the account.
US08474696B2
Systems and methods for performing test procedures for measuring and defining the sensitivity of payment terminals to ESD (electrostatic discharge) are disclosed. In some embodiments, a plurality of test equipment in a controlled environment are used to measure the peak discharge current (Ip) when a payment device is inserted into a payment terminal during several simulated conditions. Energy levels of the discharge currents are calculated using an energy calculation program. One or more reference current and energy levels are determined.
US08474691B2
An apparatus is provided that includes a processor configured to at least perform or cause the apparatus to at least perform a number of functions. The functions include storing an order log for a fill order specifying a medication in a receptacle including an affixed label having a printed pattern of machine-readable dots or markings. The functions also include receiving a digitized signature, initials or marking handwritten on the label and captured by a digital pen based on the pattern printed on the label. The digital pen is registered to a user, and the signature/initials/marking reflects verification by the user that the medication in the receptacle is correct. Recording the events or activities also includes authenticating the user as having authority to verify the fill order based on the registration of the digital pen to the user, and when authenticated, recording the digitized signature/initials/marking in the order log.
US08474676B2
A staple refill including a refill body accommodating sheet-type connected staples. The refill body includes a bottom wall, a right wall provided on a right side of the bottom wall and formed with a vertically extending right guide slot, and a left wall provided on a left side of the bottom wall and formed with a vertically extending left guide slot. A pressing member is provided in the refill body in a movable manner to press the sheet-type connected staples. The pressing member includes a guide shaft guided along the right and left guide slots. The guide shaft includes a right end portion protruding outside the right wall through the right guide slot, and a left end portion protruding outside the left wall through the left guide slot.
US08474674B2
The invention is directed to a pill cutter that has a protected cutting edge. The pill cutter includes a guard, a base, and a cover. The components are arranged such that the guard slides over the cutting edge when the pill cutter is in an open position and the guard exposes the cutting edge when the pill cutter is in a closed position. The invention is also directed at a method for assembling the pill cutter and a method of using the pill cutter to cut a pill or tablet.
US08474671B2
A golf cart bag strap sleeve that is capable of protecting a golf bag from damage due to friction between the golf cart bag strap and the golf bag comprising a first layer of durable non-abrasive material, a second layer of foam, neoprene, cloth, or gel padding, and a third layer of durable non-abrasive material suitable for customized advertising. In the first embodiment, the three layers are folded over to form the sleeve with two open ends that engage the strap. In a second embodiment, the sleeve is comprised of two panels, both made of the first layer, second layer, and a third layer. An end cover encloses the three layers to prevent fraying and stitching secures the three layers and the end cover.
US08474659B2
Described is a multi-chamber fluid dispensing container with multiple dip tubes, and a package including the container and trigger sprayer having multiple supply lines for fluid connection to the multiple dip tubes. The container includes a body having a first wall defining a first interior volume and a second wall defining a second interior volume, a first dip tube fluidly connected to the first interior volume, and a second dip tube fluidly connected to the second interior volume. The package may include the container and a trigger sprayer coupled to the container, and fluidly connected to the first dip tube and to the second dip tube. Other embodiments may also be disclosed and claimed.
US08474651B2
A towelette dispenser is provided with an integrally molded lid. The lid has a central aperture for allowing access to a roll of towelettes maintained within a tub receiving the lid therein. The separation bar bridges the aperture, and provides a rip fence in the form of a fingered thimble that is angled with respect to the lid as a whole. The thimble is offset near one edge of the annular opening so that a user may access the back side thereof to thread an edge of the leading towelette through the thimble without having to remove the lid from the tub. A well is provided in the smaller portion of the aperture and a cap for the lid is provided with a stuffer tab to urge the leading edge of the next towelette into the well when the cap is closed. Barrier caps are also provided to seal the interior of the tub during shipment and storage before the first use of the towelette dispenser. The barrier caps have removable portions that permit access to the interior of the lid and are removable without having to remove the lid from the tub.
US08474646B2
A dispensing closure system is provided for a container that has an opening to the container interior. The preferred embodiment of the system includes a closure having a closure body for extending from the container at the container opening and a lid hingedly attached to the closure body. The closure body has a dispensing spout, and the lid includes a hollow spud for entering the spout. A spud rim can be provided on the spud, extending inwardly towards the hollow interior of the spud. A lid rim can additionally or alternatively be provided on the inside surface of the lid, positioned within the hollow interior of the spud.
US08474645B2
There is provided a waterproof case which prevents ingress of water into the waterproof case through a protection piece, including a case body formed into a rectangular tube-like shape with a peripheral wall thereof and a lower cover having a bottom wall covering a lower opening of the case body and a peripheral wall extending from the bottom wall. The peripheral wall of the body case is placed so as to cover the peripheral wall of the lower cover. The protection piece is provided at the peripheral wall of the lower cover so as to sandwich the peripheral wall of the case body with the peripheral wall of the lower cover to prevent the deformation of the peripheral wall of the lower cover. There is also provided a protrusion protruding from a surface of the peripheral wall of the case body on which the protection piece is placed.
US08474641B2
A stackable, self-standing, liquid-tight, disposable drinking cup to keep ice separated from a beverage in the cup to permit cooling without resultant dilution. A collapsible plastic film liner is secured to certain inner cup surfaces to provide a flexible wall for dividing the interior into two separate areas. The liner forms a pocket with an expandable top edge which may be pulled away from the cup body to hold ice. The pocket may be made of one film layer with the edges of the pocket attached to the cup body. Alternatively, the pocket may be made of two layers joined by a heat sealed seam with the film layer next to the cup body attached to the cup wall at least along a portion of the top edge. The container body may be manufactured from conventional materials. Conventional cup dispensers, beverage dispensers, cup lids, and straws may be utilized without modification of design.
US08474638B2
The plastic container includes a hollow body of plastic material having a lower supporting base, a sidewall extending upwardly from the lower base and an upper neck portion extending upwardly from the sidewall with an opening therein. The sidewall includes at least one panel having a central region and an outer boundary, with the outer boundary being depressed with respect to the central region.
US08474635B2
An ultrasonic liquefaction endodontic system having a graspable hand piece includes a contra-angle tip assembly that has an insert and an internal fluid flow passageway. A portion of the fluid flow passageway passes through a C-shaped receiver located at the end of the receiver so that an ultrasonic frequency may pass directly to the fluid flowing through the passageway. The fluid flow passageway may be an injection tube and the tubular body portion of the tip assembly may be injection molded around the injection tube and the insert. A supply tube, which is held in position by tube guides connected to the hand piece, provides a source of flushing fluid with and without pulsed pressure. The fluid pressure pulses may have an ultrasonic energy superimposed thereon as the fluid is forced into a root canal.
US08474632B2
A caddy for use in bathrooms is disclosed. The caddy can include removable shelf assemblies and/or accessory units for holding common household items. The removable shelf accessories can include knobs which can be turned to secure and free the shelf assemblies from a support member of the caddy. The accessory units can snap into place on the support member. The support member can include a telescoping section and biasing element which permits the caddy to adjust to different sized bathrooms. A sliding member can be incorporated to provide additional areas for attachment of shelf assemblies or accessory units.
US08474620B2
A cover display for a container in some implementations having a dome shaped cover base with a flat bottom and a top with a radius of curvature with one or more frame catches positioned near the periphery of the cover base. An adorned Tiara shaped cover with an annular wall supporting frame latches positioned to correspond to said frame catches is affixed over said dome shaped cover base.
US08474612B2
A rigid package having a group of articles; an inner package enclosing the group of articles and having an extraction opening; a reclosable sealing panel, which closes the extraction opening of the inner package, and has an inner surface gummed with non-dry, re-stick adhesive, and a grip tab with no re-stick adhesive; and a rigid outer container, which houses the inner package, and has an open end, and a lid hinged to rotate between an open position and a closed position opening and closing the open end respectively; the grip tab being designed to project from the lid when the lid is in the closed position closing the open end.
US08474607B2
A multi-link conveyor chain is provided that includes a first plurality of links and a second plurality of links positioned along the length of the conveyor chain and collectively defining the conveyor chain. The first plurality of links has a wear surface that has enhanced wear resistance in relation to a conventional wear surface of the second plurality of links. The first plurality of links may be spaced in a pattern or randomly in the chain, in various percentages in relation to the second plurality of links.
US08474602B2
Multi-piece rollers for a conveyor belt. First and second roller sections fit together to form a complete roller. The two roller sections together define a bore for receiving an axle. The bore and the periphery of the roller are formed in part by each of the first and second roller sections. The roller is assembled by sliding the two sections together in a direction perpendicular to the axle with the bore closing around the axle. The roller sections have fingers that interdigitate with each other to prevent axial separation of the first and second roller sections. The interdigitated fingers surround a majority of the bore.
US08474595B2
A system for screening carry-on baggage and other items carried by individuals is provided that includes a screening device, especially an X-ray screening device, a conveyor for conveying the items to be screened through the screening device, a support surface arranged upstream of the conveyor, a removal position for the items, arranged downstream of the conveyor, transport trays that are to be placed on the conveyor and in which small objects and items of clothing can be placed and conveyed through the screening device for screening, and a return conveyor for the empty transport trays. The return conveyor leads to a tray lift, the exit of which leads to a tray transfer path extending in parallel to the support surface, the transfer path tapering towards the support surface.
US08474593B2
A coin processing machine for processing coins of various diameters includes an elongate guide surface that guides coins moving along a coin path extending beside and along the guide surface, and sets of first and second coin sensors spaced along the path. Each first and second coin sensor is associated with a respective coin diameter. The coin sensor signals are transmitted to a controller that recognizes the value of a coin associated with a pair of first and second sensors only when both sensors signal the presence of a coin. If only the first sensor signals the presence of a coin, the controller may generate an output signal indicating the presence of a misaligned coin moving along the coin path.
US08474585B2
The invention relates to a clutch device, for example, a booster clutch device, including a first clutch element and a second clutch element, where a torsion spring device is provided coupling the first clutch element to the second clutch element, the torsion spring device having a multi-stage spring characteristic.
US08474584B2
A tamper evidencing band for encircling an article includes an elongate strip. The band is provided with a loop. The loop is such that attempted opening or removal of the loop will be evidenced by the band. The strip has a portion distal from the loop, which is insertable through the loop. Attachment means is provided to selectively attach the distal portion onto another portion of the strip to encircle the article whereby attempted removal of the attachment will be evidenced by the band. The tamper evidencing band may be provided as a flat strip with the loop unformed. Alternatively, the tamper evidencing band may be provided in kit form with a separate buckle to define the loop.
US08474578B2
A brake beam wear liner for receiving a brake beam assembly of a railway car truck includes a base wall having an inner surface and an outer surface extending between opposite side edges, and having a base wall thickness between the inner surface and the outer surface thereof. The brake beam wear liner also includes sidewalls extending from the opposite side edges. The sidewalls have inner surfaces and outer surfaces, and have a sidewall thickness between the inner surface and the outer surface thereof. The inner surfaces of the sidewalls and the inner surface of the base wall define an open ended trough configured to receive an end of the brake beam assembly. The brake beam wear liner also includes flanges extending outward from the sidewalls. The flanges have inner surfaces and outer surfaces, and have a flange thickness between the inner surfaces and the outer surfaces thereof. The base wall thickness is greater than the sidewall thickness.
US08474573B2
The invention relates to a composite sandwich panel (1) comprising at least a web (2) provided between an inner skin (3) and an outer skin (4), each skin being made of a composite material from a plurality of fibrous plies (5, 6, 7, 8), characterized in that a portion of the plies of the inner skin and/or of the outer skin each extends at least partially through the web at an uninterrupted area thereof in order to form together a through-reinforcement (9) extending from the inner skin to the outer skin of the composite sandwich panel. The invention further relates to an aircraft element including such a composite sandwich panel.
US08474561B2
A quad-bike vehicle (10) having a chassis (12), four wheels (14) rotatably mounted on the chassis (12), an engine (16) for driving at least two of the wheels (14), a seat (18) for a user, a handlebar (20) for steering at least two of the wheels (14), a tow-hitch (22), and a carrier device (24) for mounting on the tow-hitch (22). The carrier device (24) has a foldable platform (26), a back (28), and a tow-hitch attachment element (32) for releasable attachment to the tow-hitch (22). The platform (26) is foldable towards the back (28) to adopt a storage condition, and is foldable down to adopt an in use condition. Preferably, the platform (26) and the back (28) are both planar or substantially planar so that, when folded together, the platform (26) and the back (28) lie in parallel or substantially parallel with each other. With the platform folded down, the carrier device is spaced from the ground. A carrier device (24) which is specifically adapted for a quad-bike vehicle (10) is also provided.
US08474558B2
There is provided a duct, an inlet portion of which is disposed so as to be exposed to an upper-side portion of an air intake opening and an outlet portion of which connects to an inlet of an intake passage of an engine. There can be provided an engine intake passage structure of a front vehicle body which can properly reduce a risk of the water coming into the inlet of the intake passage of the engine even when the vehicle travels on the flooded road.
US08474541B2
A drill pipe and a method of applying hardbanding thereto. A hardbanding alloy comprising iron and manganese present in the range of 67 to 87 weight percent (wt. %), niobium and chromium present in the range of 9 to 29 wt. %, and boron, carbon and silicon present in the range of 3 to 6.5 wt. % may be welded around at least a portion of a tool joint circumference. The hardbanding alloy may exhibit a hardness of 45 Rc to 70 Rc and a wear rate in the range of 0.08 grams to 1.60 grams of mass loss after 6,000 cycles as measured using ASTM G65-04, Procedure A.
US08474540B2
The connector comprises a male flange 15 and a female flange 14 allowing to assemble a main tube and auxiliary line tubes 11. A locking collar 17 and a locking ring 40 assemble the male flange and the female flange. Locking collar 17 is mounted mobile in rotation on the outer surface of the male flange while cooperating with the outer surfaces of the male and female flanges. Locking ring 40 is mounted mobile in rotation on the male element of the connector while cooperating with the inner surface of the female connector.
US08474539B2
The present disclosure provides an improved design for a pull tube sleeved stress joint and associated pull tube for managing stresses on a catenary riser for a floating offshore structure. The pull tube sleeve stress joint includes at least one sleeve surrounding a length of the pull tube with an annular gap between the sleeve and pull tube and a link ring therebetween. For embodiments having a plurality of sleeves, a first sleeve can be spaced by an annular first gap from the pull tube and coupled thereto with a first ring between the pull tube and the first sleeve, and a second sleeve can be spaced by an annular second gap from the first sleeve and coupled thereto with a second ring between the first sleeve and the second sleeve. Both pull tube and sleeves can be made with regular pipe segments welded together with regular girth welds.
US08474530B2
An apparatus for indicating the orientation of a structure which includes an orienting sub releasably connected at an outer case. The orienting sub is at a preselected orientation relative to the structure. A change in fluid pressure of a predetermined magnitude of flow rate through the orienting sub will indicate that the structure is at a desired orientation in the well.
US08474528B2
Apparatus and methods for gravel packing. The method is particularly useful for deploying a sand screen assembly having shunt tubes. The apparatus can include two or more tubulars disposed about at least one expandable member. The tubulars are longitudinally aligned with one another and bundled together in a run-in position, and the bundled tubulars radially expand when the expandable member is activated.
US08474523B2
A method of and apparatus for treating a zone in a well is disclosed. A tube that is permeable to a material is inserted into a wellbore, creating an annulus inside the wellbore. Two zones—the annular region and the formation surrounding the wellbore—may be treated. The method comprises the following steps. (1) A setting section surrounded by a sleeve is placed inside the tube near the zone to treat, the sleeve being expandable and impermeable to the material. (2) The sleeve is inflated inside the tube near the zone to treat, ensuring that a first zone of the tube is impermeable to the material, but leaving a second zone permeable to the material. (3) A treatment fluid is pumped to the zone to treat, the treatment fluid passing into the annulus via the second zone. (4) The zone to treat is treated with the treatment fluid.
US08474520B2
A string for drilling a well for installation and retrieval of ESP equipment without a rig. A well is drilled past the end of casing which has been cemented in place and extends to a wellhead at the surface. A receptacle is attached between production casing joints and run into the well 10. The receptacle is a tubular member with an inclined pocket formed on a side. At least one passage or port in the pocket intersects with a passage in receptacle with one or more lengths of tubing attached to the pocket. A wet connector within the production casing is landed in the receptacle and self aligns to the tubing. Electrical wires run within the tubing mate and lock with the wet connector. This allows an ESP to be run into the well via winch such that it stabs into the wet connector to receive power.
