US10248105B2
A main controller may be used to provide integrated, centralized, and optimized handling of telematics data in welding arrangements. The main controller may receive from other components of a welding arrangement, telematics data, and may apply at least some processing to the telematics data, to enable use of the telematics data by a remote entity. The telematics data may comprises data relating to an engine used in driving one or more components of the welding arrangement, data relating to one or more components of the welding arrangement, and/or data relating to welding operations performed via the welding arrangement. The processing of telematics data may comprise formatting data in accordance with a single standard format, digitizing analog data, and/or processing data for communication to the remote entity. The main controller may provide telematics client and/or host node functions, such as based on the controller area network (CANBus) protocol.
US10248099B2
A programmable logic controller executes an SFC program including a plurality of blocks, each including a step indicating an operation output and a transition indicating a transition condition. The programmable logic controller includes an SFC device data collecting unit for collecting device data of a device included in an active step for each scan at the time when the SFC program is executed, an SFC device data storing unit for storing the data collected by the SFC device data collecting unit, and an SFC device data outputting unit for outputting the data stored in the SFC device data storing unit to a memory card as a file for each of the steps or the blocks.
US10248095B2
A numerical control device includes a multicore CPU for outputting a position command value of a servomotor, an ASIC including a servo controller, which outputs a current command value to an amplifier for driving the servomotor, and another processor, and a DSP for reading the position command value and controlling the servomotor such that the servomotor moves to a position indicated by the position command value. The CPU and the ASIC are connected through a plurality of serial interfaces.
US10248092B2
A thermostat may include one or more memory devices comprising a stored setpoint schedule, one or more temperature sensors configured to provide temperature sensor measurements, and a processing system configured to be in operative communication the one or more memory devices to determine a setpoint temperature, and in still further operative communication with a heating, ventilation, and air conditioning (HVAC) system to control the HVAC system based at least in part on the setpoint temperature and the temperature sensor measurements. The processing system may be configured to control the HVAC system by receiving an indication that a total instantaneous energy usage rate for a structure in which the thermostat is installed is projected to exceed a threshold amount; and altering the stored setpoint schedule to reduce an energy usage rate of the HVAC system.
US10248082B2
A timepiece movement includes: a barrel wheel; a ratchet wheel; a rotary weight; a transmission wheel that causes the ratchet wheel to rotate; a pawl lever that engages with the transmission wheel, is interlocked with the rotary weight, and performs forward/backward movement in directions of approaching and moving away from the transmission wheel; a base panel; and a wheel train bearing provided between the base panel and the rotary weight. The pawl lever and the transmission wheel are positioned between the base panel and the wheel train bearing. The transmission wheel is pivotally supported by the wheel train bearing. The wheel train bearing is provided with a release portion for releasing the pawl lever and the transmission wheel from engagement therebetween by moving the pawl lever.
US10248081B2
A holographic display includes a pixel array including one or more pixels, a holographic data source, a drive array, and a light source. Each pixel includes a phase-modulating structure and an amplitude-modulating structure. The holographic data source is configured to supply a holographic drive signal. The holographic drive signal includes, for each pixel in each of a plurality of time-varying holographic image frames, a phase component defining phase modulation for the pixel and an amplitude component defining amplitude modulation for the pixel. The drive array is configured to, for each pixel in each holographic image frame, modulate the phase-modulating structure according to the phase component and modulate the amplitude-modulating structure according to the amplitude component. The light source is configured to output coherent light to illuminate the one or more pixels of the pixel array.
US10248074B2
A developer cartridge comprises a first gear. The first gear may include a first protrusion extending in a radial direction of the first gear. The first protrusion may be positioned at a circumference of a column of the first gear. The first protrusion may be spaced apart from a second end face opposite to a first end face facing an exterior surface of a casing configured to accommodate developer therein. The first protrusion may be further from the second end face than a large-diameter gear in an axial direction. A rotational circumference of the first protrusion defined by rotation of the first protrusion and a portion of the large-diameter gear are aligned in the axial direction.
US10248052B2
An image forming apparatus includes a transfer unit, a resistance detection unit, and a changing unit. The transfer unit transfers an image to a continuous recording medium. The resistance detection unit detects a resistance of the recording medium at a position upstream of the transfer unit in a transport direction of the recording medium. The changing unit changes a transfer condition of the transfer unit in accordance with a detection result of the resistance detection unit.
US10248051B2
A developing method in a developer device having a developing roller configured to rotate within a housing, the developing roller having a first portion that is exposed through an opening of the housing, a second portion at which developer attached to the developing roller separates from the developing roller and a third portion between the first and second portions, and an elastic sheet in contact with the developing roller between the second and third portions of the developing roller, the method includes guiding airflow along a first airflow passage, which is formed in the housing and partially facing the second portion of the developing roller, and guiding airflow along a second airflow passage facing the third portion of the developing roller and adjacent to the first airflow passage.
US10248047B2
A toner case includes a case main body and a cover. The case main body stores a toner. The cover covers a face of the case main body at one end side in a longitudinal direction of the case main body. An inside projection or an inside recess is provided on an inner face of the cover at a position to be touchable from an outside. A number of the inside projection or the inside recess is determined based on a color of the toner stored in the case main body.
US10248043B2
In a case where a collection mode in which an exposure unit forms a first potential on a photosensitive member and a developing unit collects discharging toner discharged from the developing unit to a position where the first potential is formed is executed, a potential forming unit forms, on an intermediate transfer member, a potential same as a normal charging polarity of toner and an absolute value greater than an absolute value of the first potential, and a charging power supply applies, to a charging member, a voltage having a polarity same as the normal charging polarity and an absolute value greater than an absolute value of the first potential.
US10248042B2
The electrophotographic roller has a surface layer comprising an electro-conductive elastic layer on an electro-conductive substrate. The opening of a bowl-shaped resin particle is exposed on the surface of the electrophotographic roller. The number of contact portions of the convex portion with the glass plate in a square region where a length of a nip in a direction along the circumferential direction of the electrophotographic roller of a nip formed by pressing the roller on the glass plate with a specific load applied as the length of one side and is located at any position in the nip is 8 or more. The average value of the areas of the contact portions is 10 μm2 to 111 μm2. The variation coefficient of the areas of the contact portions and the variation coefficient D of the areas of a plurality of Voronoi regions each including a contact portion satisfy specific relationships.
US10248041B2
A developing unit includes a body and a displacement member. The displacement member is to be held by the body in a first mode in a first mounting state, and is to be held by the body displaceably between the first mode and a second mode in a reversible fashion in a second mounting state. The first mounting state is a state in which a first toner cartridge is mounted on the developing unit. The second mounting state is a state in which a second toner cartridge is mounted on the developing unit.
US10248040B2
An electrostatic latent image developing carrier includes carrier particles each including a carrier core and first and second coat layers covering a surface of the carrier core. The first and second coat layers give a layered structure in which the first coat layer and the second coat layer are layered in order from the surface of the carrier core. The first coat layer contains a fluororesin. The second coat layer contains a silicone resin and a fluorine silane in an amount of at least 1% by mass relative to a mass of the silicone resin. An area SA of a region of a surface region of the first coat layer that is covered with the second coat layer and an area SB of a region thereof that is not covered with the second coat layer satisfy a relationship represented by “0.05≤SB/(SA+SB)≤0.50”.
US10248024B2
The invention relates to a method for making a micro- or nano-scale patterned layer of material by photolitography, comprising steps of: positioning a photomask between a light source and a layer of light sensitive material, said mask comprising a support and a layer of micro- or nano-light focusing elements fixed to the support, activating the light source so that the light source emits light radiations through the mask towards a surface of the layer of light sensitive material, developing the layer of light sensitive material so as to obtain the micro- or nano-scale patterned layer of material, wherein, during exposure of the layer of light sensitive material to light radiations, the photomask is positioned relative to the light sensitive layer so that the distance between the surface of the light sensitive layer and the layer of micro- or nano-light focusing elements is greater than a back focal length of the micro- or nano-light focusing elements.
US10248021B2
Provided are a polymer that can be favorably used as a positive resist having a low film reduction rate in a state of low irradiation with ionizing radiation or the like and a positive resist composition that can favorably form a high-resolution pattern. The polymer includes an α-methylstyrene unit and a methyl α-chloroacrylate unit, and the proportion of components having a molecular weight of less than 6,000 in the polymer is no greater than 0.5%. The positive resist composition contains the aforementioned polymer and a solvent.
US10248007B2
There are provided a mounting device and an imaging unit through which it is possible to easily perform various imaging techniques with an imaging device that cooperates with an information processing device according to cooperation between the devices. Provided is a mounting device that enables an imaging device configured to transmit an image to an external display device to be detachable from an external device, the mounting device including: a first mounting portion configured to be mounted on the imaging device; a second mounting portion configured to be mounted on the external device; and a rotation mechanism through which the first mounting portion and the second mounting portion are rotatable.
US10248002B2
In an optical circuit using a Mach-Zehnder-type element, it is difficult to obtain an optical circuit which has a less wavelength dependence and is suitable for achieving high integration. Accordingly, an optical circuit according to the present invention includes: a first Mach-Zehnder-type element including a first branch waveguide, a first branching/combining unit connected to one end of the first branch waveguide, and a second branching/combining unit connected to another end of the first branch waveguide and having a branch configuration different from that of the first branching/combining unit; and a second Mach-Zehnder-type element including a second branch waveguide, a third branching/combining unit connected to one end of the second branch waveguide, and a fourth branching/combining unit connected to another end of the second branch waveguide and having a branch configuration different from that of the third branching/combining unit. The first branch waveguide and the second branch waveguide each include a phase difference adjustment means. In the second branching/combining unit and the third branching/combining unit, light coupling between two basic modes with a phase inverted and a higher-order mode, is smaller than that in the first branching/combining unit and the fourth branching/combining unit. The first Mach-Zehnder-type element and the second Mach-Zehnder-type element are connected with each other through the second branching/combining unit and the third branching/combining unit.
US10248001B1
A varifocal block includes liquid crystal (LC) lens and a liquid lens structure in optical series. The LC lens has a plurality of optical states, including an additive state that adds optical power to the LC lens and a subtractive state that removes optical power from the LC lens. The liquid lens structure comprises a transparent substrate layer, a deformable membrane, and a volume of liquid enclosed between the transparent substrate layer and the deformable membrane. The deformable membrane has an adjustable range of optical power dependent on an adjustable curvature of the deformable membrane. The plurality of optical states of the LC lens and the adjustable range of optical power of the liquid lens structure together provide a continuous range of optical power for the varifocal block.
US10247998B2
An electro-optic Mach-Zehnder modulator includes a first optical waveguide forming a first arm of the Mach-Zehnder modulator, and a second optical waveguide forming a second arm thereof. The first or second optical waveguide includes capacitive segments that are spaced apart from one another, each forming an electrical capacitor. A travelling wave electrode arrangement applies a voltage across the first or second optical waveguide. The travelling wave electrode arrangement includes waveguide electrodes arranged on the capacitive segments , an electrical line extending along a part of the first or second optical waveguide, the electrical line being arranged a distance from the waveguide electrodes, and connecting arrangements, each being assigned to one of the waveguide electrodes. Each connecting arrangement includes at least two connecting structures spaced apart from one another wherein the waveguide electrodes each are electrically connected to the electrical line via the assigned two connecting structures.
US10247987B2
The present disclosure provides a pixel unit, an array substrate and a manufacturing method thereof. The pixel unit comprises slit electrodes and comprises four zones. The slit electrodes in the four zones are electrically connected with each other. The slit incline directions of the slit electrodes of the pixel unit in each of the four zones are the same, and the slit inclined directions of the slit electrodes of the pixel unit in any two adjacent zones of the four zones are different. The pixel unit structure with a plurality of domains and the array substrate comprising the pixel unit structure provided by the present disclosure can eliminate color deviation to the greatest extent, and have excellent light transmittance.
US10247986B2
Disclosed is a backlight module. The backlight module includes a backplane. The backplane is provided with a groove therethrough. Two sides and/or two ends of an optical diaphragm of the backlight module each are connected with a bendable flap which passes through the groove and is attached to the backplane. The backlight module has a simple structure without a plastic frame or a frame sealant, and an optical diaphragm in the backlight module can be fixed. A super narrow frame of the backlight module can be realized.
US10247984B2
A backlight module including a back board, a reflector, at least one light source, at least one lens unit, and a light leakage feature is disclosed. The reflector includes a base and at least one side wall connected to the base and is disposed on the back board. The light source is disposed on the board and emits light. The lens unit is disposed on the light source and configured to diffuse the light emitted from the light source for generating light rays impinging on the side wall. The light-leakage feature is disposed at the side wall and configured to allow some of the light rays to pass through the side wall.
US10247979B2
The present invention pertains to a polarizing film having a transparent layer on at least one surface of a polarizer, wherein: the polarizer contains a polyvinyl alcohol-based resin and has a thickness of 15 μm or less; the transparent layer-side of the polarizer has a compatible layer thereon having compatibility with the transparent layer; and the thickness A of the polarizer and the thickness B of the compatible layer satisfy the general formula (100×B/A)≥1. This polarizing film has crack resistance and suppresses changes in the dimensions of the polarizer.
US10247977B2
A display device includes: a substrate; a gate line disposed on the substrate; a data line intersecting the gate line; a plurality of thin film transistors connected to each of the gate line and the data line; a plurality of pixel electrodes connected to each of the plurality of thin film transistors; first-color, second-color and third-color filters, respectively, overlapping the plurality of pixel electrodes; and a light blocking portion disposed between two adjacent pixel electrodes of the plurality of pixel electrodes, wherein the light blocking portion comprises: a first-color layer comprising a substantially same material as that included in the first-color filter; a third-color layer comprising a substantially same material as that included in the third-color filter; and a fourth-color layer overlapping over the first-color and third-color layers and absorbing a light having a wavelength in a range from 540 nm to 680 nm.
US10247975B2
Embodiments provide a display device including: a thin film transistor disposed on an insulation substrate including a plurality of pixels; a common electrode and a pixel electrode disposed on the thin film transistor to overlap each other while interposing an insulating layer therebetween; a liquid crystal layer filling microcavities differentiated by pixel electrodes, the pixel electrodes comprising the pixel electrode; and a roof layer that is disposed on a microcavity of the microcavities and includes an injection hole extending to the microcavity and a supporting member to support the microcavity; and an optical member disposed on the supporting member, wherein the injection hole is disposed between adjacent microcavities in a column direction, and the supporting member is disposed between adjacent microcavities in a row direction. Total reflection of light, bad alignment, and light leakage which may occur in the display device may be prevented by the optical member.
US10247971B2
There is provided a flexible display having a new wire structure and a new insulating layer structure. A flexible display includes a flexible substrate having a first area and a second area. The second area is curved in a non-zero angle relative to the plane of the first area. The flexible display further includes a plurality of wires that extend over from the first area to the second area of the flexible substrate. Each of the wires is covered by an upper insulating pattern, which is separated from other upper insulating pattern. Each upper insulating pattern covering the wire has substantially the same trace pattern shape of the corresponding wire thereunder. Accordingly, by adopting the above-described wire structure and upper insulating layer structure, crack generation and propagation in the wires and the insulating layers from bending of the flexible display can be minimized.
US10247967B2
A Mach-Zehnder modulator (MZM) includes a first optical path with a first diode coupled to a first voltage signal node and configured to modify a phase of a first light signal transmitted through the first optical path. A further diode is positioned in the first optical path and configured to introduce a phase shift to the first light signal. A second optical path includes a second diode coupled to a second voltage signal node and configured to modify a phase of a second light signal transmitted through the second optical path. A first voltage signal carried on the first voltage signal node and a second voltage signal carried on the second voltage signal node each vary between a reverse biasing voltage level and a forward biasing voltage level. An optical coupler is coupled to the first and second optical paths.
US10247963B2
Method for optical design of a pair of ophthalmic lenses and pair of ophthalmic lenses thus obtained
Disclosed is a method for optical design of a pair of ophthalmic lenses for correcting spherical and cylindrical refractive errors of the eyes of a wearer, including a step of defining the need for spherical and cylindrical correction of the wearer for various viewing distances, and a step of determining the spherical and cylindrical power of the ophthalmic lenses at viewing points with various proximities, in accordance with the correction needs of the wearer. The power of at least one of the two ophthalmic lenses is determined such as to limit the deviation obtained therebetween upon adding equivalent spherical power between the viewing points with various proximities and/or varying the cylindrical power vector between the viewing points with various proximities. Also disclosed is a pair of ophthalmic lenses designed according to such a method.
US10247959B2
An articulated assembly includes a first piece connected to a second piece by a screwless hinge having a body with a cylindrical axial recess of revolution which opens onto at least one of the axial faces of the body and a cylindrical hub of revolution, with a diameter corresponding to that of the axial recess, fully housed in the axial recess; this hub including a radial cavity opening onto its periphery, and the lateral wall of the body having an opening of predetermined angular extent. The first piece includes an end provided with fixing elements arranged to be fixedly attached to the hinge body, the second piece includes an end provided with coupling elements suitable for being introduced into the radial cavity through the body opening and with retaining elements cooperating, in the in-use position introduced into the axial cavity of the hub, with the cylindrical wall of revolution.
US10247958B1
The present invention includes an apparatus and a method for retaining eyeglasses on a remote panel with a holding element positioned on the remote panel and a temple element positioned on the eyeglasses.
US10247950B2
A three-dimensional display panel includes an array of pixels arranged in row and column directions, and at least one lenticular lens configured to form N viewpoints in different directions. The at least one lenticular lens has a longitudinal axis inclined by an angle of θ with respect to a column direction of the pixel, and a pitch P of the at least one lenticular lens in the row direction thereof satisfies ( N S ) A < P < ( ( N + 1 ) S ) A , where N is the number of the viewpoints and is an integer greater than or equal to 1, S is the number of the lenticular lenses used to form the N viewpoints and is an integer greater than or equal to 1, and A is a width of each pixel in the row direction.
US10247948B2
The display device includes the first light-emitting element, a second light-emitting element, a first color filter through which light from the first light-emitting element passes, and a second color filter through which the light from the second light-emitting element passes. The relative positional relationship between the center of the first light-emitting element and the center of the first color filter is different from the relative positional relationship between the center of the second light-emitting element and the center of the second color filter.
US10247947B2
Certain exemplary embodiments can provide a system, machine, device, manufacture, circuit, composition of matter, and/or user interface adapted for and/or resulting from, and/or a method and/or machine-readable medium comprising machine-implementable instructions for, activities that can comprise and/or relate to, via light from a light source, rendering an image on a retina.
US10247933B2
For image recording purposes, an object is illuminated at a plurality of illumination angles. A detector captures a plurality of images (41-43) of the object for the plurality of illumination angles. An electronic evaluating device applies an image correction to at least some of the plurality of images (41-43), said image correction comprising a displacement (T1, T2), wherein the displacement (T1, T2) depends on the illumination angle (4) used when recording the respective image (41-43). The corrected images (44-46) may be combined.
US10247928B2
A zoom lens includes, in order from the object side, a first lens unit having negative refractive power, a second lens unit having positive refractive power, a third lens unit having negative refractive power, and a fourth lens unit having positive refractive power. At a time of zooming from a wide-angle end to a telephoto end, the distance between the first lens unit and the second lens unit is reduced, the distance between the third lens unit and the fourth lens unit is increased, and the fourth lens unit is fixed.
US10247925B2
An innovative design for a compact objective lens for use with a digital image intensification camera is described, which uses lenses made with gradient index materials to reduce the number of lens elements required, length and weight over conventional objective lens systems.
US10247922B1
The present disclosure discloses a camera optical lens. The camera optical lens includes, in an order from an object side to an image side, a first lens, a second lens, a third lens, a fourth lens, a fifth lens, a sixth lens and a seventh lens. The camera optical lens further satisfies specific conditions.
US10247913B2
An optical image capturing system includes, along the optical axis in order from an object side to an image side, a first lens, a second lens, a third lens, a fourth lens, a fifth lens, a sixth lens, and a seventh lens. At least one lens among the first to the sixth lenses has positive refractive power. The seventh lens can have negative refractive power, wherein both surfaces thereof are aspheric, and at least one surface thereof has an inflection point. The lenses in the optical image capturing system which have refractive power include the first to the seventh lenses. The optical image capturing system can increase aperture value and improve the imaging quality for use in compact cameras.
US10247907B2
An exemplary support structure for a planar faceplate includes ribs extending substantially perpendicular to a bottom surface of the planar faceplate. Spaced apart projections extend from the ribs towards the bottom surface of the planar faceplate and have distal ends that engage and are secured to the bottom surface. Each distal end defines an area with a numerical value that is less than the thickness of the planar faceplate measured in the same measurement units as the area to limit any stress formations induced in the planar faceplate due to thermal changes from reaching a top surface of the planar faceplate. Alternatively, the projections may be spaced apart mesas extending outward from a rigid material.
US10247900B2
Disclosed is a method for manufacturing an intermittently connected optical fiber ribbon that includes a plurality of optical fibers arranged side by side, and connection parts arranged intermittently and each connecting two adjacent optical fibers. The method involves: a step of applying, between the optical fibers, a UV-curable resin including a siloxane structure in its molecule; a step of removing a portion of the UV-curable resin applied between the optical fibers; and a step of irradiating the UV-curable resin between the optical fibers with UV rays and forming the connection parts.
US10247895B2
A system includes a first blade including a first side of the first blade, a second side of the first blade, a front of the first blade, and a back of the first blade. The system further includes a second blade including a first side of the second blade, a second side of the second blade, a front of the second blade, and a back of the second blade. The system further includes a first side plane including a first physical communication channel configured to communicatively connect the first blade to the second blade via the first side of the first blade and the first side of the second blade.
US10247893B1
Optical connector assemblies and optical cable assemblies incorporating a supplemental input voltage are disclosed. In one embodiment, an optical connector assembly includes housing and an electrical connector at a face of the housing. The electrical connector includes an input voltage contact for receiving an input voltage. The optical connector assembly further includes voltage converter operable to convert the input voltage to an output voltage at a converter output, a voltage clamping device electrically coupled to the converter output, and a supplemental voltage conductor. The output voltage is greater than the input voltage. The supplemental voltage conductor is electrically coupled to an output of the voltage clamping device and provides a supplemental output voltage at an output of the voltage clamping device. The optical connector assembly further includes an active optical circuit that converts electrical data signals into optical signals.
US10247892B2
A transceiver module having a partitioned housing, e.g., a bifurcated or multi-segment housing, is disclosed that allows coupling and alignment of a TOSA arrangement and ROSA arrangement in separate respective portions in order to minimize or otherwise reduce component damage and rework iterations during manufacturing and repair. Technicians may thus perform at least partial assembly and testing of each optical subassembly arrangement in parallel and in relative isolation without necessarily interrupting and/or waiting on completion of the other. In a general sense, each separate portion of the partitioned housing provides a dedicated workspace of about equal dimension for coupling of subassembly components. Each separate portion may lie flat on a tabletop, for instance, which may further simplify manufacturing processes and provide a wide-range of acceptance angles for performing soldering, welding, insertion and coupling of components, visual inspection, fiber routing, and so on.
US10247883B2
A composition for an optical waveguide is cured into a sheet to give a cured product. A difference in light transmittance with respect to light having a wavelength of 450 nm is 15% or less between this cured product and this cured product after retention in atmosphere at 175° C. for 40 hours, the light transmittance being calculated in terms of the cured product at a thickness of 50 μm.
US10247882B2
Provided is an optical waveguide circuit avoiding the difficulty of the property compensation based on temperature control, compensated with respect to the property variations due to fabrication error, particularly paid attention in a silicon waveguide, and being low in power consumption and high in performances. The optical waveguide circuit includes a silicon (Si) substrate, a buried oxide film (BOX) layer formed on the Si substrate, and an SOI (Silicon on Insulator) layer, formed on the BOX layer, including an optical element utilizing the SOI layer as a main optical transmission medium. At least part of a waveguide of the optical element includes uniformly distributed and thermally unstable crystal defects.
US10247879B2
A light guide assembly includes a light guide plate, at least one first light source, and at least one second light source. The light guide plate has a main body, at least one first light incident structure, and at least one second light incident structure. A center of the main body has a through hole, and a straight line passing through the through hole defines a first half part and a second half part of the main body. The first light incident structure protrudes from the first half part and extends away from the main body, and the second light incident structure protrudes from the second half part and extends away from the main body. The first light source is located on an edge of the first light incident structure. The second light source is located on an edge of the second light incident structure.
US10247878B2
A light guide plate (LGP) includes a positioning block that includes a positioning block body and a liquid filled and hermetically sealed in a receiving compartment formed in the interior of the positioning block body. The liquid is expandable with a drop of temperature so as to increase a volume thereof and thus enlarge a size of the positioning block body through elasticity of the positioning block body. In this way, the LGP positioning block is adjustable with the variation of the surrounding temperature so as to achieve effective positioning of the light guide plate and providing high reliability of a liquid crystal display device including the light guide plate.
US10247873B2
Disclosed is a lighting device of a vehicle capable of achieving an enhancement in luminous efficacy. The disclosed lighting device includes a light source for generating light, a light guide including a light emitting portion formed with first patterns arranged in a longitudinal direction of the light emitting portion, to guide the light, the light emitting portion performing light emission using the light, and a light receiving portion to receive the light generated by the light source, and a back cover, on which the light guide is mounted. The back cover is formed with second patterns arranged in a longitudinal direction of the back cover at a portion of the back cover, on which the light receiving portion is mounted. The first patterns are formed to have a greater width with increasing distance from the light source. The second patterns are formed to have the same width.
US10247862B2
A mirror, in particular for a microlithographic projection exposure apparatus, has a mirror substrate (101), a reflection layer system (102) configured to reflect electromagnetic radiation that is incident on the optically effective surface (100a), and a capping layer (104), which is arranged on the side of the reflection layer system (102) facing the optically effective surface. The capping layer is produced from a first material. Particles (105) of a second material, either individually or in clusters, are applied onto this capping layer, wherein the second material differs from the first material.
US10247848B2
A 3Helium gas counter comprising a container, a gas tube within the container, and a mixture of 3Helium and Xenon or a mixture of 3Helium and Krypton. A method of making a 3Helium gas counter comprising providing a container, placing a gas tube within the container, and depositing a mixture of 3Helium and Xenon or a mixture of 3Helium and Krypton into the gas tube.
US10247845B1
A high-Q human-portable, battery-powered self-correcting tunable transmitter apparatus for inducing alternating currents in buried conductors to facilitate their location is disclosed.
US10247839B2
Described herein is a land seismic data acquisition system comprising a central processing unit; a cabled network connected to the central processing unit comprising a plurality of acquisition lines each comprising: electronic units assembled in series along a telemetry cable and each associated with at least one seismic sensor, the units processing signals transmitted by the sensor(s); intermediate modules assembled in series along the telemetry cable and each associated with at least one of the electronic units, each intermediate module providing power supply and synchronization of the electronic unit(s) wherewith it is associated; wherein each electronic unit is associated with at least two intermediate modules including at least one upstream and at least one downstream from the electronic unit along the telemetry cable, and comprises synchronization means independent from the cabled network, bidirectional and autonomous power supply means, bidirectional storage means of the signals processed by the electronic units.
US10247834B1
A radiation detector assembly is provided that includes a semiconductor detector, a collimator, plural pixelated anodes, and at least one processor. The collimator has openings defining pixels. Each pixelated anode is configured to generate a primary signal responsive to reception of a photon and to generate at least one secondary signal responsive to reception of a photon by at least one surrounding anode. Each pixelated anode includes a first portion and a second portion located in different openings of the collimator. The at least one processor is operably coupled to the pixelated anodes, and configured to acquire a primary signal from one of the pixelated anodes; acquire at least one secondary signal from at least one neighboring pixelated anode; and determine a location for the reception of the photon using the primary signal and the at least one secondary signal.
US10247833B2
There is provided a measurement circuit (30) for an x-ray detector (5). The measurement circuit (30) is configured to sample measurement data to generate data points and process the data points before read-out to produce new data points by combining two or more data points which have been acquired at different times such that the number of data points for read-out are less than the number of original data points.
US10247827B2
Optical apparatus (64) includes a stator assembly (47), which includes a core (78, 90, 91) containing an air gap and one or more coils (80, 92, 94, 116, 120) including conductive wire wound on the core so as to cause the core to form a magnetic circuit through the air gap in response to an electrical current flowing in the conductive wire. A scanning mirror assembly (45, 83, 85, 130) includes a support structure (68), a base (72), which is mounted to rotate about a first axis relative to the support structure, and a mirror (46), which is mounted to rotate about a second axis relative to the base. At least one rotor (76, 132) includes one or more permanent magnets, which are fixed to the scanning mirror assembly and which are positioned in the air gap so as to move in response to the magnetic circuit. A driver (82) is coupled to generate the electrical current in the one or more coils.
US10247817B2
Parameters of a propagated object state in a radar tracking system are converted from an object state domain to a measurement domain. The measurement domain includes parameters of a superposition of a chirp and a Doppler frequency of the reflected signal and the Doppler frequency. Deltas between measured states and propagated states are computed in the measurement domain to improve updating of the object state. An object track is more accurately updated based on the object state delta. Data association may be performed simultaneously in both the measurement domain and object domain. Propagated object state parameters in object domain coordinates can be checked for signal collisions to avoid signal collision errors. An improved noise model is also constructed in the measurement domain.
US10247815B1
A phased array radar system comprises an array antenna including a plurality of selectively controllable transmit/receive (T/R) modules. One or more computer processors and associated memory devices are provided in communication with the plurality of T/R modules. The control processor is configured to cause the transmission of a first plurality of radio frequency (RF) pulses from a first portion of the array antenna, wherein the first plurality of pulses comprise at least two pulses having distinct center frequencies. A second plurality of RF pulses are transmitted from a second portion of the array antenna, wherein the second plurality of pulses comprise at least two pulses having distinct center frequencies. Received return signals originating from the first and second plurality of transmitted pulses are non-coherently integrated prior to the performance of target detection operations.
US10247803B2
Systems and methods for designing and/or using radio frequency (“RF”) pulses for in-vivo MRI applications, where the RF pulses are robust against errors due to physiological motion of organs during the respiratory cycle. For example, RF pulses are designed based on multi-channel B1+ maps correlated to different positions of the respiratory cycle.
US10247794B2
A magnetic field monitoring probe includes a first container having a sample configured to emit a magnetic resonance (MR) signal included therein; a radio frequency (RF) coil inserted into the first container and configured to receive an MR signal emitted from the sample; and a second container surrounding the first container and having a matching liquid injected thereinto.
US10247787B2
A system and method to detect the loss or disruption of one or more phases of a three phase alternating current (AC) power source used in the operation of a valve actuator. The loss of one or more phases of a three phase AC power source may cause a peak in AC power output. While a peak in AC power output may not affect an operation of electronic circuitry, all three phases are often required to safely operate other hardware components, such as an AC motor that is associated with the valve actuator. Therefore, in response to detecting the loss or disruption of at least one phase of a three phase AC power source, this disclosure presents a system and method to inhibit damaging operations such as operating an AC motor associated with a valve actuator, and continuing to operate communications and diagnostic circuitry to report the condition.
US10247784B2
[Summary][Object] To accurately detect a state of a secondary battery when the secondary battery is mounted on a vehicle.[Organization] In a secondary battery state detecting device 1 detecting a state of a secondary battery 14 which is mounted on a vehicle, a first operation mode being an initial operation mode in a case newly connected to the secondary battery and a second operation mode being a normal operation mode after the first operation mode are included, and an initial state detecting unit (control part 10) which makes the operation mode transit to the first operation mode, and detects an initial state of the secondary battery with reference to a terminal voltage of the secondary battery in a case connected to the secondary battery; and a normal state detecting unit (control part 10) which makes the operation mode transit to the second operation mode, and detects the state of the secondary battery at a normal time based on the terminal voltage and a charge/discharge current of the secondary battery at a predetermined timing after the state of the secondary battery is detected by the initial state detecting unit are included.
US10247781B2
Various apparatus and methods associated with a compact electronics test system having user programmable device interfaces and on-board functions adapted for use in various environments are provided. Exemplary embodiments can include a variety of apparatuses and methods to realize an advanced field programmable gate array adapted to perform functional tests on digital electronics within an exemplary 48-pin DIP footprint. One aspect of the invention can include a testing device comprised of components to produce a product that is inexpensive and consumable. A small size of an exemplary embodiment of the invention further allows for desirable shielding to be placed around a highly portable and highly programmable and adaptable testing device in order to protect it from external dangers found in harsh environments (e.g., high levels of radiation when operating in space, etc.).
US10247780B2
The PRPG provides the test stimulus to the circuit, but it can only generate a finite number of care-bits from any given input seed which limits the maximum coverage that can be achieved. The only way to increase the coverage is to provide additional seed input data to the PRPG. The on-chip one time only programmable eFuse is used to store new PRPG seed data inputs and corresponding MISR output signature data for comparison. An XOR circuit option on the output of the MISR is operable to further compress the output data.
US10247763B1
A voltage detecting glove comprises a glove liner and an outer glove shell. A conductive antenna is disposed inside the outer glove shell but separated from the glove liner by a buffer. The antenna is connected to electronic circuitry configured to sense a voltage indicative of the proximity of the antenna to an AC electric field resulting from energized AC source, and to activate an alarm if the strength of the field exceeds a preselected threshold limit.
US10247757B2
An improved meter base assembly supports the various meter forms used in modern electrical energy distribution systems. The disclosed assembly combines a customized design for each meter form with a universal base used in a plurality of meter forms to create a meter base assembly that is optimized for best performance while maintaining a reduced part cost. In addition, the concept allows the meter terminals to be attached to the meter base assembly without any hardware, may reduce assembly errors, allows for simplified assembly that may be automated, and speeds up the creation of future meter designs.
US10247752B2
Described is a system which includes: a cable including: a first fiber optic interconnect to provide an input light; and a second fiber optic interconnect to provide an output light; and a first housing coupled to the cable, the first housing including: a first deflection circuit to deflect the input light received from the first fiber optic interconnect in response to a vibration or movement of the first housing; and a second housing coupled to the cable, the second housing including: a light source to generate the input light for transmission to the first deflection circuit via the first fiber optic interconnect; and a photo detector to receive the output light from the first deflection circuit via the second fiber optic interconnect.
US10247750B2
The present invention provides an online measuring method of particle (such as bubbles, droplets and solid particles) velocity in multiphase reactor. The method based on an online multiphase measuring instrument includes the following steps: (1) the online multiphase measuring instrument is placed into the multiphase reactor, and then a particle image produced by two or more exposures are obtained; (2) the actual size of individual pixel in the particle image is determined; (3) valid particles are determined in the depth of field; (4) then the centroid coordinates are conversed to the actual length of the coordinates (xt,i, yt,i) and (xt+Δt,i, yt+Δt,i) using the actual size of individual pixel. Thus, the instantaneous velocity of particles can be calculated by V i = ( x t + Δ t , i - x t , i ) 2 + ( y t + Δ t , i - y t , i ) 2 Δ t . The method can realize real-time measurement of the velocity distribution of bubbles, droplets or solid particles in a multiphase reactor, and the measurement accuracy is high.
US10247744B2
A method and system for automatic in-vitro diagnostic analysis are described. The method includes adding a first reagent type and a second reagent type to a first test liquid during a first and second cycle times respectively. The addition of the first reagent type to the first test liquid includes parallel addition of a second reagent type to a second test liquid during the first cycle time. The addition of the second reagent type to the first test liquid includes parallel addition of a first reagent type to a third test liquid during the second cycle time, respectively.
US10247737B2
A method of classifying a subject having idiopathic scoliosis (IS) or at risk of developing IS comprising: determining the cellular response to Gi stimulation in a cell sample from the subject in the presence of OPN; determining the cellular response to Gi stimulation in a cell sample from the subject in the absence of OPN; and comparing the cellular response obtained in the presence of OPN with the cellular response obtained in the absence of OPN, whereby the comparing step enables the classification of the subject into one IS functional group. Also provided is the use of the foregoing method to classify borderline subjects and kits for applying the methods.
US10247736B2
Described herein are methods for evaluating the risk of preterm birth in pregnant subjects. The methods involve detecting and quantifying one or more biomarkers associated with preterm birth in a biological sample from the subject. Also described herein are isolated biomarkers and kits useful in predicting the risk of preterm birth.
US10247734B2
Multimenic lectins having a β-propeller architecture, formed from monomer modules of approximately 30 to 60 amino acids, in which the binding sites to the glycans are situated on a given side of the proteins and the O-terminus and N-terminus ends of the peptide chains on the other side of the proteins, characterized in that they are formed from 4 to 7 monomer modules, a single, or a plurality of, or all of the adjacent modules being linked to one another by the linkers linking the N-terminus end of one module to the C-terminus end of the adjacent module.
US10247729B2
Disclosed are methods and kits for early detection of antigen exposure through the presence or absence of antigen-specific antibodies.
US10247725B2
A new sensitive cell biomarker of solid tumors is identified in blood. This biomarker can be used to determine presence of carcinomas, rapid determination of treatment response, early detection of cancer, early detection of cancer recurrence, and may be used to determine therapy.
US10247718B2
Embodiments include an apparatus for determining a pull-out capacity of a bolt disposed in concrete. The apparatus includes control processing circuitry and a Schmidt hammer electrically connected to the control processing circuitry. The Schmidt hammer is configured to strike the bolt during a test event and to record a rebound value for the bolt. The control processing circuitry is configured to calculate an estimated pull-out strength for the bolt using the rebound value of the bolt that resulted from the test event, a predetermined bolt diameter, a predetermined bolt embedment length in the concrete, and an estimated predetermined strength of concrete. The apparatus also includes a remote computer configured to communicate with the control processing circuitry and to store an estimated pull-out strength of the bolt. The control processing circuitry includes a memory and a database.
US10247715B2
A sensor for detecting an analyte in a liquid. The sensor includes an antenna, covered with a layer of a molecularly imprinted polymer capable of interacting with an analyte and inducing a variation in the characteristics of the antenna within the microwave frequency range.
US10247713B2
There is described an indicator device for indicating the passage of time, the indicator device comprising an indicator section and a barrier section adjacent thereto, said indicator section comprising: an indicator material; a substrate material; and a first adhesive layer; the indicator material and the substrate material being in the form of one or more layers; the indicator material displaying different visible properties in response to the presence or absence of a chemical agent and/or the concentration thereof; the barrier section comprising a removable barrier layer, the removable barrier layer being substantially impermeable to the chemical agent; wherein on removal of the removable barrier layer, the concentration of the chemical agent in the indicator section changes over time, effecting a visible change. The device may be used to detect the presence/absence of oxygen, water, carbon dioxide, an amine, ammonia, and/or carboxylic acids or to indicate the passage of time.
US10247708B2
Micromachined ultrasonic transducers integrated with complementary metal oxide semiconductor (CMOS) substrates are described, as well as methods of fabricating such devices. Fabrication may involve two separate wafer bonding steps. Wafer bonding may be used to fabricate sealed cavities in a substrate. Wafer bonding may also be used to bond the substrate to another substrate, such as a CMOS wafer. At least the second wafer bonding may be performed at a low temperature.
US10247707B1
A new cement formulation includes a base cement slurry and an admixture of acoustic metamaterial particles, the acoustic metamaterial particles each having a dense inner core and compliant surrounding matrix. The cement formulation exhibits a substantial increase in transmission loss over the base cement slurry at a first frequency, and does not exhibit a substantial increase in transmission loss over the base cement slurry at a second frequency. A new cement interrogation technique involves transmitting acoustic energy at and near the band-gap frequency of an acoustic metamaterial, detecting an acoustic response and analyzing it for band-gap performance involving substantially elevated transmission loss at or near a given first frequency that rapidly falls off at nearby frequencies, determining that the cement formulation is present in regions exhibiting band-gap performance, and determining that the cement formulation is not present and/or has been compromised in regions not exhibiting band-gap performance.
US10247706B2
System and method for enabling ultrasonic inspection of a variable and irregular shape. The system comprises one or more ultrasonic pulser/receivers, one or more ultrasonic transducer arrays, a shoe or jig to hold and position the array(s), data acquisition software to drive the array(s), and data analysis software to select a respective best return signal for each pixel to be displayed. This system starts with information about the general orientation of the array relative to the part and a general predicted part shape. More specific orientation of the transmitted ultrasound beams relative to the part surface is done electronically by phasing the elements in the array(s) to cover the expected (i.e., predicted) surface as well as the full range of part surface variability.
US10247698B2
A gas sensor element that includes a composite ceramic layer including a plate-shaped insulating portion which contains an insulating ceramic and has a through-hole, and an electrolyte portion which contains a solid electrolyte ceramic, and a portion disposed in the through-hole where the electrolyte portion is thicker than the insulating portion. A first conductor layer is formed over a first insulating surface of the insulating portion and a first electrolyte surface of the electrolyte portion. The electrolyte portion has an extending portion which is overlaid on the first insulating surface and extends toward the outside of the through-hole. The thickness of the extending portion is decreased toward an outer periphery of the extending portion, and the outer periphery of the extending portion is continuously connected to the first insulating surface. A first extending surface of the extending portion continuously connects the first insulating surface and the first electrolyte surface.
US10247695B2
Provided are: an electrode for a gas sensor formed as a porous electrode so as to stably allow reduction in electrode resistance for excellent low-temperature activity; and a gas sensor. The electrode (108, 110) for the gas sensor is adapted for use on a surface of a solid electrolyte body (109), which is predominantly formed of zirconia, and contains particles (2) of a noble metal or an alloy thereof, first ceramic particles (4) of stabilized zirconia or partially stabilized zirconia and second ceramic particles (6) of one or more selected from the group consisting of Al2O3, MgO, La2O3, spinel, zircon, mullite and cordierite, wherein the second ceramic particles are contained in an amount smaller than that of the first ceramic particles.
US10247678B1
An arrangement for an inspection of plate-shaped objects moving relative to a camera device in a direction of motion through at least two observation areas. The arrangement includes the camera device which includes one single camera which comprises a matrix sensor, and an image processor. In a first detection state, a first observation area running diagonally opposite to the direction of motion is represented on a first image area of the camera device and is recorded as a strip-shaped image. In a second detection state, a second observation area is represented on a second image area of the camera device and is recorded as a strip-shaped image. The image processor merges the strip-shaped images recorded in the first detection state and in the second detection state to form two-dimensional images. All image areas are located on the matrix sensor.
US10247672B2
A method includes: (a) providing spatially-patterned activation radiation to a sample that includes phototransformable labels, where an optical parameter of the spatially-patterned activation radiation varies periodically in space; (b) providing spatially-patterned excitation radiation to the sample, where an optical parameter of the spatially-patterned excitation radiation varies periodically in space, where (a) and (b) create a non-linear fluorescence emission pattern within the sample, the pattern including H modulation harmonics, with H>1. The method includes (c) detecting radiation emitted from the activated and excited labels, (d) storing detected radiation data, and (e) spatially shifting one or both of the spatially-patterned excitation radiation and the spatially-patterned activation radiation with respect to the sample to spatially shift the non-linear fluorescence emission pattern within the sample, and (f) repeating (a)-(e) at least N times, with N>2. Then, a sub-diffraction-limited final image of the sample is generated based on the stored data for the N positions of the non-linear fluorescence emission pattern within the sample.
US10247667B2
Rare earth ceramic pigment luminescent nano-particle photon markers are mixed in specific proportions within cellulose slurry and extruded to form trace fiber strands. The trace fiber strands are processed into slivers and are blended with a base fiber or fibers at specific concentration levels. The number and proportion of different photon markers and their concentration levels within the yarn, thread, cloth, fabric, textile or garment generate specific photonic response signatures when examined under a spectrophotometer reader. Signatures may be assigned representing provenance, base fiber identification, base fiber concentration, the manufacturer, and/or other data throughout the manufacturing and supply chain of a finished product.
US10247665B2
The invention relates to a device tier determining a concentration of a chemical substance dissolved in a liquid, which chemical substance absorbs light (10) of an absorption wavelength, wherein the device comprises: at least one flow-through chamber (2) having at least one inlet opening (4), at least one outlet opening (6), and at least one peripheral wall (24); at least one laser (8) for emitting light (10) of the absorption wavelength; and at least one detector (18) for detecting the emitted light (10); wherein the laser (8) and the detector (18) are arranged in such a way that the light (10) emitted by the laser (8) is conducted through the flow-through chamber (2) along at least two different paths before said light hits the detector (18), and wherein the device has two lasers (8) which emit light of different wavelengths. The invention further relates to a method for producing a flow-through chamber for such a device.
US10247662B2
Technologies are described for providing optical analysis systems using an integrated computational element that has a surface patterned to selectively reflect or transmit different wavelengths by differing amounts across a spectrum of wavelengths. In one aspect, a measurement tool contains an optical element including a layer of material patterned so that the optical element selectively transmits or reflects, during operation of the measurement tool, light in at least a portion of a wavelength range by differing amounts, the differing amounts being related to a property of a sample. The wavelength range can include wavelengths in a range from about 0.2 μm to about 100 μm. Additionally, the sample can include wellbore fluids and the property of the sample is a property of the wellbore fluids.
US10247660B2
A laser displacement meter includes: a laser array beam source unit including a plurality of lasers emitting beams with different wavelengths; a lens array unit including a plurality of lenses for focusing laser beams; a reflected beam lens array unit including a plurality of focusing lenses for focusing the beam reflected on the surface of the object; an optical filter array unit including a plurality of optical filters through which the reflected beam is selectively transmitted; and a photodetector array unit including a plurality of photodetectors for detecting the beam transmitted through the optical filters.
US10247654B2
A method and a device for calculating a consumed lifespan are provided. The method includes: controlling an electric motor of a purifier to rotate at a predetermined speed; acquiring a value of a sampled parameter of the electric motor, the sampled parameter being at least one of a sampled current and a sampled voltage of the electric motor; and determining a consumed lifespan of the purifier according to the acquired value of the sampled parameter, wherein the consumed lifespan is in positive correlation with the acquired value of the sampled parameter.
US10247640B2
Methods and systems for improving the uniformity of a tire are provided. More particularly, one or more parameters of a measurement process harmonic contributing to uniformity measurements performed for a tire can be identified. The measurement process harmonic can be a process harmonic effect associated with the acquisition of uniformity measurements of a tire, such as a process harmonic effect associated out-of-roundness of a road wheel used to load a tire during uniformity measurement in a uniformity measurement machine. The measurement process harmonic can result solely from the acquisition of uniformity measurements and may not contribute to actual tire non-uniformity. Once identified, the one or more parameters associated with the measurement process harmonic can be used to correct the uniformity measurements of the tire to account for the measurement process harmonic. Tire manufacture can then be modified to improve tire uniformity based on the corrected measurements.
US10247635B2
An embodiment provides an apparatus, including: a cartridge including a base and a lid; at least one fluid line located between the base and the lid of the cartridge; at least one heating element located either on the base or the lid and aligned in intimate contact with the at least one fluid line; at least one heat sensing element in intimate contact with the at least one fluid line, where the at least one heat sensing element is spaced downstream from the at least one heating element; a supply of power to the cartridge; and a processor in electrical communication with the cartridge that executes a program of instructions to: operate the at least one heating element to produce heating of the at least one fluid line at a first position; and operate the at least one heat sensing element to detect the heat of a fluid within the at least one fluid line at a position downstream of the first position. Other embodiments are described and claimed.
US10247632B2
A pressure sensor can include a housing having a sense side cavity formed on a first side of the housing; a sense side diaphragm attached to the first side and over the sense side cavity, a sense die assembly placed in the cavity and attached to the housing; a reference side cavity formed in the housing, a reference side diaphragm attached to a second side of the housing and over the reference side cavity, and pin(s) electrically connected to the sense die assembly and extending outside the housing from the second side. The cavities are filled with oil. Manufacturing the pressure sensor can include mounting the sense die assembly onto the housing, attaching the sense side diaphragm to the first side of the housing, filling the cavities with oil, and attaching the reference side diaphragm on the second side of the housing and over the reference side cavity.
US10247629B2
A MEMS pressure sensing element and integrated circuit (IC) are mounted on a circuit board. The sensing element and IC can be either stacked or unstacked. Bond wires connect the IC to the circuit board. Other bond wires connect the sensing element to the IC. A cap covers the sensing element and IC. The cap is attached to the circuit board and has a small hole in it, through which viscous gel is inserted. The gel encapsulates the MEMS sensing element, IC and bond wires in the cap. The hole also allows pressurized fluid to enter the cap and exert force on the MEMS pressure sensing element after encapsulation in the gel. Chip capacitors can also be mounted on the circuit board, outside the cap. Electrical signals are generated, which represent pressure applied to the MEMS pressure sensing element through the hole and gel.
US10247628B2
A force measurement mechanism comprises two force input members (105, 106), a pair of cantilever springs (101, 102), and a force measuring means (107). One portion of each cantilever spring is held by a first constraint means (103) and one portion of each cantilever spring is held by a second constraint means (104) with each cantilever spring having an unconstrained length between the first and second constraint means that is free to bend. The constraint means (103, 104) hold the cantilever springs (101, 102) in a parallel and spaced apart arrangement. The force input members (105, 106) are attached via the constraint means so that relative movement of the force input members bends the cantilever springs (101, 02), and the force measuring means (107) is arranged to measure force applied between the force input members.
US10247624B2
Embodiments of the present disclosure provide self-calibrated thermal sensors of an integrated circuit (IC) die and associated techniques and configurations. In one embodiment, a self-calibrating thermal sensing device includes a resonator configured to oscillate at a frequency corresponding with a temperature of circuitry of an integrated circuit (IC) die, wherein the resonator is thermally coupled with the circuitry and configured to operate in a first mode and a second mode and logic operatively coupled with the resonator, and configured to calculate a first temperature corresponding with a first frequency of the resonator in the first mode using a first equation, calculate a second temperature corresponding with a second frequency of the resonator in the second mode using a second equation, and add an offset to the first equation and the second equation based on a result of a comparison of the first temperature and the second temperature. Other embodiments may be described and/or claimed.
US10247621B1
In a high resolution temperature sensor, first and second MEMS resonators generate respective first and second clock signals and a locked-loop reference clock generator generates a reference clock signal having a frequency that is phase-locked to at least one of the first and second clock signals. A frequency-ratio engine within the MEMS temperature sensor oversamples at least one of the first and second clock signals with the reference clock signal to generate a ratio of the frequencies of the first and second clock signals.
US10247616B2
An electronics device includes a power semiconductor device including a temperature detection diode, a first semiconductor integrated circuit device including a detection circuit for detecting VF from the temperature detection diode and a second semiconductor integrated circuit device. The second semiconductor integrated circuit device includes, an outside air temperature acquisition unit which acquires outside air temperature information, a storage which stores temperature characteristic data of the temperature detection diode and a first value based on a signal from the detection circuit at a first temperature and a temperature arithmetic processing unit which calculates a temperature of the power semiconductor device from a third value based on a signal from the detection circuit, the temperature characteristic data, the first temperature acquired by the outside air temperature acquisition unit and the first value.
US10247591B2
A new experimental device for debris flow simulation, including a material supply device, a flow channel, a stacking groove, a pole, a first high-speed camera, a second high-speed camera, a fixing frame, and a sliding rail. The material supply device is used to release the debris flow simulation material to the flow channel, to realize the start of the debris flow simulation. The stacking groove is used for the accumulation of the debris flow. The pole is used to support the stacking groove and adjust the slope of the stacking groove. The fixing frame is used to fix the first high-speed camera. The second high-speed camera can monitor the movement of the debris flow. The invention can flexibly simulate the movement characteristics of various debris flow and obtain the test data, so as to provide data support for the subsequent study.
US10247590B2
A balancing valve for adjusting the flow rate of a fluid flowing inside a pipe from upstream to downstream in a longitudinal direction of flow. The balancing valve includes: a check valve and a tubular element simulating a Venturi tube, said valve and element being coaxially connected, respectively, from upstream to downstream in the longitudinal direction of flow of the fluid; a device for detecting the difference in pressure which occurs inside the valve; a valve for adjusting the flow rate of the fluid which flows inside the pipe; wherein: the detection device is arranged between the inside of a first upstream chamber of the check valve and the inside of a central cylindrical portion of the tubular element.
US10247586B2
A sensor assembly is provided for a fingerboard latch assembly that comprises: a latch bracket; bolts for mounting the latch bracket to a fingerboard; a latch; and a bracket pin rotatably supporting the latch on the latch bracket to allow rotation of the latch between an open position and a closed position. The sensor assembly has a mounting arrangement that mounts to the bolts, holding a closed-position proximity sensor probe facing downwardly for sensing proximity of a crank portion of the latch and/or the piston head in the closed position, and also holding an open-position proximity sensor probe facing forwardly for sensing proximity of an arm of the latch in the open position.
US10247585B2
A component for a sensor having a sensor element and having an output interface for the outputting of an electrical signal, which is dependent on a physical variable, from the sensor element to the output interface, including—a circuit with at least one first signal path for receiving the electrical signal from the sensor element and for conducting the electrical signal to the output interface, and a second signal path, which differs from the first signal path, for conducting the electrical signal to the output interface, —wherein an activity of the first signal path or of the second signal path is dependent on a position of the component in the sensor.
US10247578B2
A method of path measurement uses eddy current principles and a sensor which interacts with a measuring object. The sensor has an electrical connector and a sensor coil. In accordance with the method, an operating voltage is applied to the sensor such that a magnetic field is built up by an oscillator in cooperation with the sensor coil. A measuring object may be moved in the vicinity of the sensor coil through an opening in the sensor coil to produce field strength changes adjacent to the coil and the oscillator. The field strength changes are detected by an evaluation circuit and transmitted to a microcontroller. The microcontroller processes the signals of the evaluation circuit and provides the evaluation circuit with said signals via an output and protection circuit. The sensor coil consists of a plurality of windings constructed in a planar manner.
US10247576B2
The disclosure relates to a method for verifying measured data from at least one sensor system. The measured data directly or indirectly describe values of physical quantities The values of indirectly described physical quantities are calculated from the measured data and/or from known physical and/or mathematical relationships. At least three values describing an identical quantity are subjected in pairs to a mutual comparison. In addition, at least two of the at least three values describing an identical quantity are determined independently of one another by at least one sensor system. A third value describing an identical quantity is determined by a basic sensor system. The disclosure further relates to a corresponding system and a use of the system.
US10247575B2
A vehicle accelerometer system comprises an accelerometer for installation in a vehicle, a processor for selection of accelerometer output data items for inclusion in an accelerometer output data set representative of measurements by the accelerometer at a plurality of different vehicle locations, each accelerometer output data item being representative of a respective measurement by the accelerometer, and a storage device for storing the accelerometer output data set, wherein the processor is configured to process the accelerometer output data set to determine an orientation output representative of the orientation of the accelerometer with respect to the vehicle.
US10247572B2
A method of providing a route based on surveillance zones includes: generating a total surveillance zone by displaying surveillance zones of surveillance devices on a map; if a first user requests a route, generating a route on the map based on the total surveillance zone; if an event occurs while the first user travels along the route, acquiring a surveillance image from at least one of the surveillance devices corresponding to a location at which the event occurs; and providing the surveillance image to a second user.
US10247568B2
Some embodiments of the invention provide methods for generating navigation presentations that display a device navigating a route on a map. The method uses a virtual camera that, based on detected changes to the navigation context, dynamically modifies how it captures map portions to produce navigation scenes in the presentation. The method of some embodiments identifies attribute sets describing different navigation contexts and uses these attribute sets to identify virtual camera operating styles. The method uses an identified style to specify the virtual camera's positional attributes, which define the map portions identified for rendering to produce navigation scenes over time. During the navigation presentation, each time the navigation context changes, the identified attribute set may change. This, in turn, may cause the method to select a new virtual camera operating style. When the style changes, the method modifies the way the virtual camera captures the map portion to render.
US10247566B2
An electronic navigation system configured to receive a user's entry of calendar data of a planned event into an electronic calendar, including an indication of a point of time, a geographic location, and metadata descriptive of the planned event; enter the calendar data into a user specific trained classifier; process the calendar data by the user specific trained classifier to provide a classification result indicating whether a trip is required to participate in the planned event; if a trip is required, generate and send a request including the geographic location to a second server; generate navigation data including a predicted time duration for the trip, and return a response including the navigation data to the first server; generate and send a dynamic reminder message including the navigation data to the user's telecommunication device a variable amount of time before the planned event based on the predicted time duration.
US10247563B2
In one aspect, a system and method is provided whereby map-related requests from mobile devices are used to store and aggregate routes. The routes are then used to determine optimum directions in response to subsequent requests.
US10247562B2
Method for displaying the actual range of an electric vehicle from a starting point shown on a map, in the course of which based on the given parameters of the vehicle it is determined that on a horizontal surface for a covering a certain distance how much electric consumption is necessary, how much the maximum consumption can be, it is also determined that with respect to roads with different steepness to what extent (correction factors) the actual consumption varies from the consumption on a horizontal surface, then the map data is input into the map database with respect to a hypothetical range from the starting point and from the starting point the set of discrete peak points on the map is indicated, where the steepness of the surface between two neighboring peak points is considered steady, then the costs of the various available routes are determined from the starting point with Dijkstra algorithm and using a successive iteration, where the cost between two peak points mean the value modified by the correction factor related to the given steepness of the consumption measured on a horizontal surface, then with respect to those peak points where the costs reach the determined maximum consumption, it is specified as the points indicating the real range, and the location of such points are displayed on the map.
US10247559B2
A method, apparatus and computer program product are provided to disambiguate probe points within an ambiguous probe regions to permit more reliable association with a road segment. In regards to a method, probe trajectory identifiers (IDs) of probe points along at least a portion of the first and second branches that lead away from an ambiguous probe region are separately identified and form first and second sets of probe trajectory IDs, respectively. For the ambiguous probe region, the probe trajectory IDs of probe points along a third branch that leads toward the ambiguous probe region are identified and form a third set of probe trajectory IDs. The method also includes classifying probe trajectory IDs from the third set as being associated with the first branch or the second branch in an instance in which the probe trajectory IDs are additionally included in the first set or the second set, respectively.
US10247556B2
A mobile platform having a camera for outputting image data of features with unknown locations, an inertial measurement unit for outputting inertial measurements of the features, where the coordinates of the features are unknown, a processor, storage and an extended-Kalman filter-based estimator executable on the processor for processing the inertial measurement and features of the image data, where a state vector of the estimator contains a sliding window of states for determining the position and orientation of the mobile platform.
US10247555B2
A round-robin sensing device is disclosed. The round-robin sensing device comprises a MEMS device, wherein the MEMS device includes first and second sense electrodes. The round-robin sensing device also comprises a multiplexer coupled to the first and second sense electrodes, at least one sense amplifier coupled to the multiplexer, a demodulator coupled to the at least one sense amplifier, and an integrate and dump circuit coupled to the demodulator. Finally, the round-robin sensing device comprises an analog-to-digital converter (ADC) coupled to the de-multiplexer, wherein the multiplexer, the at least one sense amplifier and the demodulator provide a continuous time sense path during amplification that is resettable and wherein the integrate and dump circuit and the ADC provide a discrete time processing path.
US10247550B2
A mobile device including an acceleration sensor, a magneto sensor, a gyroscope sensor, and a processor is provided. The acceleration sensor, the magneto sensor, and the gyroscope sensor generate acceleration data, magnetic field data, and angular velocity data, respectively. The processor determines a pitch angle and a roll angle according to the acceleration data, determines a yaw angle according to the magnetic field data, and determines a quaternion according to the pitch angle, the roll angle, and the yaw angle. Also, the processor determines orientation information of the mobile device according to the quaternion and the angular velocity data, and adjusts the orientation information according to the acceleration data and the magnetic field data.
US10247545B2
A contactless, and accurate device and methods of use thereof are provided to calibrate and verify the calibration of a robotic arm and associated attachments. The device uses a laser gauge for calibrating and subsequently verifying the calibration of the robotic arm, digitizer, or robotic tools. An optical transmitter, in communication with an optical receiver is fixed nearly perpendicular to a second optical transmitter in communication with a second optical receiver that form two optical micrometers that are offset a small distance, forming a small gap, d, to create a measuring void having two distinct non-intersecting measurement planes. One measurement plane measures the position and size of an object in a first axis direction and the other measurement plane measures the position and size of an object in a second axis direction. The position and size of an object is measured within the measuring void in both axial directions.
US10247542B2
The invention relates to a handheld measuring aid for use in a system having a station for determining the position and orientation of the measuring aid, the handheld measuring aid for surveying an object surface. The measuring aid has a body and visual markings disposed in a defined spatial relationship, forming a pattern, on the body in a marking region. In addition, the measuring aid has a connection for receiving a measuring, inspection or processing tool, wherein the connection has a joint, such that the tool is pivotable or rotatable in at least one direction. Furthermore, the connection or tool has a position encoder for determining the rotational position of the joint or tool.
US10247531B1
A fragmentation casing includes a monolithic tube defined by an alternating axial arrangement of first and second rings. Each first ring is a contiguous ring of fused powder defining spaced-apart first elements of the fused powder and at least one second element of the fused powder joining adjacent ones of the first elements. Each second ring is a contiguous lattice of the fused powder. Each of the first elements is contiguous with a portion of the lattice associated with at least one of the second rings.
US10247529B2
A shot shell is disclosed. The shot shell includes a casing, a projectile, a cushion wad having a sabot, a propellant, and a primer for igniting the propellant. The projectile, the cushion and the propellant are contained within the casing. The projectile includes a reactive material pellet that is partially covered by a taper-shaped inert capsule.
US10247528B1
A target includes a sheet of a material, the sheet includes an uprange-facing surface, a downrange-facing surface, an upper end, a lower end, and opposed sides each formed with an origami structure. Each origami structure is a partially cut-out and foldable structure formed in the material of the sheet being foldable from an unfolded condition to a folded condition. Each origami structure is flattened in a direction toward the downrange-facing surface of the sheet, when in the unfolded condition, and forms a sleeve structure deployed rearwardly from the downrange-facing surface of the sheet that is adapted to receive a support pole therein for retaining the sheet to the support pole, when in the folded condition.
US10247522B2
An unconsolidated impact and penetration resistant laminate comprises a plurality of cross-plied sheets, each cross-plied sheet further comprising (i) first and second layers of fibrous or non-fibrous ultra-high molecular weight polyethylene and (ii) first and second layers of thermoplastic adhesive, each adhesive layer having a basis weight of no greater than 5 gsm, wherein (a) the layers of polyethylene and thermoplastic adhesive alternate within the sheet, (b) at least 50 percent of the polyethylene layers are arranged such that the orientation of the first polyethylene layer is offset with respect to the orientation of the second polyethylene layer, and (c) the plurality of cross-plied sheets form a stack that, when subjected to compaction at a pressure of 255 bar and a temperature of 132 degrees C., will not suffer a pressure loss greater than 8 bar within the first two minutes as measured by Test Method B.
US10247520B2
A quick attachment coupling system to attach tactical or tool accessories, providing the ability to interchange accessories on the fly, which can be modified to fit or be integrated to the magazine base of a pistol, the fore-end of a long gun, the exterior of wearable tactical gear, or any other supporting structure. The coupling system includes a dock. Each accessory tool is fitted with a tang which slides into a tang slot in the dock where it is automatically secured for use by a spring-loaded lock switch. A core plug in the tang slot holds the lock switch in an unlocked position when the accessory tool is uncoupled from the dock.
US10247516B1
The disclosed subject matter relates to a range finder device with integrated aiming elements. These aiming elements can include, for instance, a view of a target or field of view including the target and a correction reticle. The range finder device can determine a distance to the target, which can be presented along with the aiming elements in an integrated fashion to, e.g., facilitate more accurate, more convenient, or improved aiming of a projectile device.
US10247506B1
An indirect fire mission training round includes a projectile training shell having an outer periphery, a proximal end, and a distal end, the proximal end defining an interior chamber. The projectile training shell is configured to be inserted within a cavity of a projectile firing instrument. The round includes an interlock member configured to securely receive a proximal portion of a subsequent training round within the interior chamber of the projectile training shell. The round includes a resistance brake extending outward from the outer periphery and configured to contact a wall of the cavity of the firing instrument and provide resistance that secures the projectile training shell at a position within the cavity. The resistance break is selectively disengageable such that the position of the projectile training shell is adjustable.
US10247505B1
A firearm system for monitoring the displacement of a firearm trigger during a trigger pull includes a firearm body including a handle and a barrel attached to the handle. A trigger is attached to the firearm body, and a position input circuit is attached to the trigger. The position input circuit emits a trigger position signal including information representative of the trigger displacement. The firearm body is in wired or wireless communication with an electronic device. The electronic device can include a monitor, or screen, for graphically displaying a trigger position indicator representative of the displacement of the trigger along one or more axes. The firearm body can include a motion sensing circuit generally adapted to detect motion of the firearm body. The motion sensing circuit can include one or more accelerometers or gyroscopes. A wireless transmitter or transceiver can be positioned on the firearm body for communicating trigger displacement information and/or firearm body motion information to the electronic device. Methods of providing firearm user input information to a firearm user are also provided.
US10247500B2
A modular bolt assembly may include a bolt body, a striker assembly, and one or more removable bolt, head having a floating fixing pin, The removable bolt head may have a cartridge engagement surface, a back end that removably mates with a bolt body, and a floating firing pin with a front end that contacts a cartridge primer, and a rear end that receives force from the striker assembly. Bolt heads may be included for different caliber cartridges, allowing the modular bolt assembly to be used with different types of ammunition, the floating firing pin prevents the striker assembly from directly contacting a chambered round without the bolt head, thereby preventing catastrophic failure during use if a boll head is not present and properly positioned.
US10247497B2
A firearm gas redirection assembly directionally directs discharged gases from a barrel towards a bolt frame, and uses the energy from discharged gases to force a bolt rearwardly in an action. The barrel has an elongated body, an inner barrel sidewall, an outer barrel sidewall, a rear end, and a forward end. The forward end of barrel forms gas vents. The barrel is fixed motionless on the frame of the weapon. A jet nozzle concentrically couples around the barrel and integrates with a bolt frame. The jet nozzle has inner and outer jet sidewalls and a jet nozzle edge. The inner jet sidewall and outer barrel sidewall form a gas space that is in communication with the bolt frame. Discharge of firearm forces high velocity gas through gas vents that form in the barrel, through gas space, and finally against the jet nozzle edge. This forces bolt frame rearwardly.
US10247496B2
A charging handle for a firearm which has a handle portion connected to a pull rod member. A bore hole collects exhaust gases passing over the top of the rod member and directs the gases to vent tunnel(s) which extend perpendicular to the rod member. In the preferred embodiment, a deflecting surface is used to further direct the exhaust gases to the bore hole. Further embodiments provide seals to protect the user from any exhaust gas which has not been vented.
US10247495B2
A fluid heat exchange apparatus including a casing, and a heat-dissipating device is provided. The casing includes a chamber, an inlet, and an outlet. The chamber includes a first channel including a first entrance and a first exit and a second channel including a second entrance and a second exit. The cross-sectional area of the first channel decreases from the first entrance to the first exit and the cross-sectional area of the second channel decreases from the second entrance to the second exit. The heat-dissipating device is located between the first exit and the outlet. A first fluid flows from the inlet and flows through the first channel and the heat-dissipating device and then flows to the outlet. Part of the first fluid flowing through the heat-dissipating device absorbs heat and forms bubbles moving to the second channel and then forms a second fluid converging into the first channel.
US10247493B2
A component coupling system for controllable heat transfer from or to a component which is heated by an external and/or internal heat source and is disposed adjacent to a cooler. The component coupling system includes a carrier plate, on which least one first means for spacing is disposed such that a component disposed on the means for spacing and the carrier plate, together with the means for spacing, form a first cavity. If needed, this cavity can be evacuated, filled with a fluid medium, or have a fluid medium flow through it, whereby the heat transfer or the heat dissipation from the component can be controlled in a simple manner.
US10247484B2
A head condenser is provided with a plate heat exchanger which has first and second channels through which media can flow and which, for the first medium, form tubes between individual plates that are connected to each other to form a pair of plates and, for the second medium, form waves between pairs of plates that are connected to each other to form a stack of plates. A condenser housing is provided in which the plate heat exchanger is arranged, wherein the condenser housing provides pressure chambers which extend over the large outer surfaces of the plate heat exchanger and are in fluidic connection with the channels for the first or second medium. The pressure chambers are traversed by fluid lines which are in fluidic connection with the respectively other first or second medium.
US10247483B2
A evaporative cooling device is described having a pair of heat conducting plates arranged in spaced, generally parallel relationship with spacing elements separating the plates from one another and defining primary and secondary flow channels between the plates. Inlet ducts are connected to the primary channels and outlet ducts connect from the primary and secondary channels. A water distribution system is also provided to supply water to the secondary channels such that a primary air flow through the primary channels may be cooled by heat conduction along the plates to cause evaporation of the water into a secondary air flow through the secondary channels.
US10247475B2
A nail lamp is configured to cure light-curable nail product on a user's nail. The lamp includes a base and a support with discrete light sources that each may emit with the same or different light wavelength profiles, and each may emit continuously or with the same or different pulsing functions. The lamp also includes source reflectors and a ring reflector. The different wavelength profiles are configured to, in combination, cure a light-curable nail product. The pulsing function is used to cure the nail product more efficiently. The source reflectors and ring reflector are used to target specific areas of the nail. A space is disposed between the base and the support and is sized to accommodate therein the nails of an appendage of a user so as to expose the user's nails to light from the discrete light sources.
US10247474B2
Microwave drying of ceramic honeycomb logs using a customizable cover that can take the form of a flexible wrap or a rigid cover is disclosed. The cover can be in the form of a wrap disposed directly in contact with the leading edge of the log surface. The cover can also be a rigid cover disposed adjacent but not in contact with the leading edge of the log surface. At least a portion of the trailing edge of the log can remain uncovered either by having windows in the wrap or by the rigid cover only covering the leading edge of the log surface. The customizable cover can be configured to compensate for log shape deformities as well as or in addition to the adverse effect on log shape cause by the drying differential created by passing a log through a microwave drying station leading-edge first.
US10247465B2
The present invention relates to a cooling device comprising a body; a thawing body that is disposed in the body, wherein the frozen foods are placed; a heater that heats the thawing compartment and a sensor that provides the measurement of the humidity of the ambient air of the thawing compartment.
US10247461B2
Disclosed herein are aspects and embodiments of an air conditioning system and a method of operating the air conditioning system. In one example, an air conditioning system includes a compressor selectively operated by a first power source and a second power source.
US10247459B2
A refrigeration cycle apparatus includes a refrigerant circuit including a compressor, a condenser (outdoor heat exchanger), an expansion valve, and an evaporator (indoor heat exchanger), a fan configured to blow air to the condenser, a fan configured to blow air to the evaporator, and a controller configured to control at least one of a frequency of the compressor, an opening degree of the expansion valve, a rotation speed of the fan, and a rotation speed of the fan, such that the refrigerant sucked into the compressor has a quality of 1.0 or greater. The refrigerant circuit is configured for use with a refrigerant mixture inclusive of 30 wt % to 50% wt ethylene-based hydrofluorocarbon refrigerant.
US10247458B2
Method for improving efficiency of a chilled water system having a chiller unit, circulation pumps, a heat absorption unit and a heat rejection unit, including adjusting a temperature of at least one of a chilled water supply to the heat absorption unit and a condenser water supply from the heat rejection unit; measuring efficiency of the chiller unit and at least one of the circulation pumps, the heat absorption unit and the heat rejection unit; further adjusting temperature of at least one of the chilled water supply to the heat absorption unit and the condenser water supply from the heat rejection unit if the measuring the efficiency indicates an improved efficiency; and further adjusting the temperature of the at least one of the chilled water supply to the heat absorption unit and the condenser water supply from the heat rejection unit if measuring the efficiency indicates worsened efficiency.
US10247452B2
A device for supporting a person may include a thermoelectric generator configured to receive heat provided from the person. The device may further include a first heat conductor overlapping the first thermoelectric generator and configured to conduct the heat to the thermoelectric generator. The device may further include a second heat conductor overlapping the first heat conductor and configured to conduct the heat to the first heat conductor. The first heat conductor may be disposed between the first thermoelectric generator and the second heat conductor. The second heat conductor may be softer than the first heat conductor. The device may further include a heat sink thermally connected to the first thermoelectric generator.
US10247448B2
A method of producing refrigeration includes compressing a refrigerant composition including R1233zd in a compressor having a magnetic bearing, within a chiller system.
US10247447B2
Positioning a radiation collection device such as a solar oven using a positioning system attached to an outside of a building structure. The positioning system allowing the collection device to be positioned in a plurality of locations where at least one of the plurality of locations is away from the building structure to allow the radiation collection device to collect solar radiation.
US10247439B2
A control mechanism for controlling an air conditioning system includes an optical sensor and an energy controller. The air conditioning system includes a solar power module, an outdoor unit, a fan, and a storage device containing a first liquid. The optical sensor detects sunlight received by the solar power module. The energy controller controls the outdoor unit based on luminance and temperature of the sunlight, an operation state of the fan, an operation state of the outdoor unit, a temperature of the first liquid, a flow speed of a second liquid in a conduit between the storage device and the fan, and temperatures of the second liquid at different portions of the conduit.
US10247437B2
An area abnormality detecting system includes multiple apparatuses, multiple sensors and a detecting server. The system is adopted in a space, which is segmented into several blocks with same size. Multiple areas of the space are defined by the blocks separately. The apparatuses are respectively corresponding to each area for providing environmental improving services. The sensors are respectively corresponding to each area for sensing indoor environment of each area. After an abnormality occurs, the detecting server determines an abnormal area and an occurring time corresponding to the abnormality, and obtains apparatus parameters of apparatuses corresponding to the abnormal area that are recorded at the occurring time, so as to determine the occurring reason for the abnormality based on the apparatus parameters.
US10247424B2
An oven appliance includes a hinge assembly. The hinge assembly couples a door to slide assemblies such that the door is pivotable. The hinge assembly includes a hinge arm that extends through an opening of the door. The hinge arm has a plurality of rounded edges at the opening of the door. A gasket is mounted to the door at the opening of the door. The gasket extends around the hinge arm and contacts the hinge arm at the rounded edges of the hinge arm.
US10247421B2
A tool for decoupling a telescoping tube from a first liner of a gas turbine engine is disclosed. The tool includes a rod partially positioned in a telescoping tube passage. The rod includes a first portion having a non-circular cross-section and a threaded second portion positioned in a second combustion chamber. A plug couples to the rod and engages a first side surface of the telescoping tube. A base defining a base passage extending therethrough is positioned in a second combustion chamber. The base passage includes a first portion having a non-circular cross-section. The first portion of the rod is at least partially positioned in the first portion of the base passage. A handle threadingly couples to the rod. Rotating the handle in a first direction moves the handle along the rod toward the first combustor to decouple the telescoping tube from the first liner.
US10247419B2
A liner panel for use in a combustor of a gas turbine engine, including a multiple of heat transfer ribs located in at least one discrete area of the liner panel. A wall assembly within a gas turbine engine including a support shell, a liner panel mounted to the support shell via a multiple of studs and a multiple of heat transfer ribs located in at least one discrete area on a cold side of the liner panel, each of the multiple of heat transfer ribs account for the multiple of studs.
US10247414B2
Coal-fired boiler exhaust gas treatment apparatus and coal-fired boiler exhaust gas treatment method
An exhaust gas treatment apparatus which includes a denitration device, a dust collector, and a desulfurization device in order, respectively, in a flow path of exhaust gas discharged from a boiler, wherein a heavy-metal component removal device is provided in the exhaust gas flow path between the dust collector and the desulfurization device. This device is provided with: an absorption tower including a nozzle which sprays acidic absorption liquid on the exhaust gas, a tank which stores liquid which has absorbed a heavy metal, and a pump which supplies the nozzle with the liquid in the tank; a neutralizing tank which neutralizes the liquid drawn from the absorption tower; and a separator which separates the neutralized liquid into a solid and a liquid component. Since a small amount of heavy metal can be removed in the absorption tower, re-emission of the heavy metal by the desulfurization device is prevented.
US10247401B2
A lighting device includes an illumination part, and a power connection part adapted to transfer outside power to the illumination part and for preventing an electrical short circuit. The power connection part includes at least two power connectors which are separated from each other and into which the external power is transferred and an insulator provided between the at least two power connectors and coupled with the at least two power connectors.
US10247399B1
A lighting structure includes a junction box that has a cavity, and a mounting plate that has an inner section and a perimeter section. The junction box is attached to the mounting plate, and the mounting plate has a wire opening therethrough for routing an electrical wire from the junction box to a light source. The perimeter section of the mounting place is outside the junction box.
US10247397B2
A retrofit trim lighting device is provided. In example embodiments, the retrofit trim lighting device comprises a bracket comprising an opening; at least one torsion spring secured to the bracket and configured to mount the retrofit trim lighting device within a recessed housing; a retrofit housing comprising at least one light engine; and an engagement element. The engagement element is secured to the retrofit housing through the opening of the bracket such that, when so secured, the retrofit housing and the bracket are rotatable relative to one another.
US10247389B2
A light fixture assembly includes a housing having an interior surface, a ballast mounted on the interior surface of the housing, a first reflector releasably coupled to the interior surface of the housing, the ballast being substantially enclosed between the housing and the first reflector when the first reflector is in a first, closed position and being exposed when the first reflector is in a second, open position spaced from at least a portion of the interior surface, a lens releasably coupled to the housing, the first reflector being substantially enclosed between the lens and the housing when the lens is in a first, closed position and substantially exposed when the lens is in a second, open position. This construction provides relatively easy and quick access to the ballast for replacement and from below the fixture if it is mounted in or on the ceiling.
US10247378B2
Provided are a metal PCB, a headlight module having the metal PCB applied thereto, and a method for assembling the headlight module, wherein the metal PCB has a base made of a metal material and configured as a thin plate, or the base has a predetermined thickness and is bent in a desired direction through a bending groove formed on the rear surface thereof, and the base has a plurality of chip mounting portions integrated thereon such that one or more LED chips are mounted thereon, the chip mounting portions being spaced at a predetermined interval and having at least two parts of incision surfaces formed on one side of the base such that the chip mounting portions are inclined and installed to have a predetermined angle with regard to the base.
US10247373B1
A lighting system can include a luminaire and a bracket for mounting the luminaire to a structure during installation. The bracket can be configured for mounting to the structure independent of the luminaire. Once the bracket is mounted, the luminaire can be hung or suspended from the bracket to facilitate wiring the luminaire. Once the hung luminaire is wired, the installer can readily move the luminaire into a long-term operating position with respect to the bracket and fasten the luminaire to the bracket with a clip or other appropriate fastener.
US10247359B2
A liquefied natural gas transportation/distribution and vaporization management system includes a transportation/distribution platform, on which at least one gas transportation/distribution section, a vaporization treatment section, and a central management section are arranged. The gas transportation/distribution section allows at least one liquefied natural gas train to unload liquefied natural gas. The vaporization treatment section is connected to the gas transportation/distribution section. The vaporization treatment section includes therein at least one fuel cell module, so that heat exchange may be conducted with byproduct of thermal energy and water generated in a power generation operation of the fuel cell module to vaporize liquefied natural gas from the gas transportation/distribution section and to feed the vaporized natural gas into a local area gas supply pipeline or a temporary gas storage section for storage and for feeding to the fuel cell module of the vaporization treatment section. The central management section receives the electrical power generated by the fuel cell module of the vaporization treatment section and is connected to and controls transportation/distribution and vaporization of the liquefied natural gas and management, monitor, and control of the output of the vaporized liquefied natural gas of the gas transportation/distribution section and the vaporization treatment section.
US10247356B2
A configurable industrial safety relay device allows individual adjustment of rated input currents for each safety input. The safety relay device can support a number of programmable configuration settings or parameters, including parameters that allow a desired input current to be individually selected for each safety input. In this way, an input current can be selected for each safety input that is appropriate for the safety circuit being monitored by the safety input. In particular, an input current can be selected that ensures reliable detection of the safety signal by the safety input while substantially minimizing power consumption by the safety relay device.
US10247347B2
An absorber for use in a fluid delivery system is disclosed which includes a housing defining an interior chamber, a connective fitting extending from the housing in fluid communication with the interior chamber for connecting the housing to the fluid delivery system, and at least one gas-filled bladder or cell disposed within the interior chamber of the housing to accommodate changes in fluid characteristics, such as, for example, pressure and volume, within the fluid delivery system, the gas-filled bladder or cell having a predetermined pre-charge pressure and a multi-layered flexible polymeric shell including a plurality of successive relatively thin polymeric shell layers to inhibit the formation of leak paths through the shell in the event that a single shell layer fails.
US10247344B2
A fluid passage structure includes a first flow passage and a second flow passage crossing with each other via a crossing portion in a casing, the crossing portion including a pair of arc-shape recessed portions formed to be a pair of arc-shape lines arranged in line symmetrical positions with respect to an axis of the second flow passage in a view along an axis of the first flow passage, each arc-shape line being a part of a cross sectional contour of the first flow passage; and an inside projecting portion formed between the arc-shape recessed portions to project toward an inside of the first flow passage by connecting each end of the arc-shape lines, each end being closer to the axis of the second flow passage than the other end of a corresponding one of the arc-shape lines in the view along the axis of the first flow passage.
US10247342B2
A connector body for use in a connector assembly for making fluid connections includes a hollow connector body, the hollow connector body comprising a resilient deformable seal having a central aperture and a lip surrounding the central aperture; a locking mechanism integrally formed with the hollow connector body, the locking mechanism comprising at least one lug including a slot, and at least one ramp; a hollow connector first body end and a second body end; and an anti-actuation assembly engagement portion comprising at least one recess and/or at least one protrusion; and a removable anti-actuation assembly comprising at least one peel strip, and at least one recess and/or at least one protrusion, the at least one recess and/or at least one protrusion being engaged with the anti-actuation assembly engagement portion of the hollow connector body. Connector assemblies and processes for making fluid connections using the assemblies are also provided.
US10247341B2
A quick connect fitting has a coupling assembly, a socket assembled on the coupling assembly, multiple blocking balls, multiple locking balls, and an operating assembly. The multiple blocking balls and the multiple locking balls are mounted in the socket. The operating assembly is mounted around the socket and has a first operating sleeve, a first compression spring, a second operating sleeve, and a second compression spring. The first operating sleeve is blocked by the multiple locking balls. The first compression spring abuts against both the first operating sleeve and the coupling assembly. The second operating sleeve is blocked by the multiple blocking balls. The second compression spring abuts against both the first operating sleeve and the second operating sleeve. Operating the first operating sleeve and the second operating sleeve sequentially can safely remove a plug.
US10247338B2
Systems and methods for dockside regasification of liquefied natural gas (LNG) are described herein. The methods include providing LNG from a LNG carrier to a regasification vessel. The LNG may be regasified on the regasification vessel. The regasified natural gas may be discharged with a high pressure arm to a dock and delivered onshore. The regasification vessel may be moored to the dock. The LNG carrier may be moored to the regasification vessel or the dock.
US10247323B2
A shut-off valve housing (1) for installing in a sanitary device, such as in a cistern (2), comprises a water-guiding channel (3) which is arranged in the shut-off valve housing (1) and has an inlet (4) and an outlet (5). The shut-off valve housing (1) comprises a housing element (8) made of plastic and at least one connector element (9) made of metal which is connected to the housing element (8), wherein the water-guiding channel (3) extends through the housing element (8) and through the connector element (9).
US10247313B2
A spray gun includes a spray gun main body and an adjustment valve. The spray gun main body has an air intake passage, a first air outlet passage, a second air outlet passage, and a mounting hole defined therein. The mounting hole is in communication with the air intake passage, the first air outlet passage and the second air outlet passage. The adjustment valve is mounted to the spray gun main body and located in the mounting hole. The adjustment valve includes a first operating member and a second operating member. The second operating member is movably mounted on the first operating member.
US10247312B2
A disposable device for the sterile transfer of fluids, such as liquids or gases, includes a body, a bore formed through at least a portion of the interior of the body, and a linearly moveable plunger contained within the bore. The body is formed from a rotating section and a stationary section. Partial rotation of the rotating section around a portion of the stationary section and the plunger drives the plunger linearly within the bore, opening and closing the device. The plunger includes at least a first and a second opening, and a fluid channel in the interior of the plunger connecting the first and second openings forming a fluid pathway to downstream components when the device is open. A termination component at one end of the plunger connects to a downstream component. A flange at one end of the body attaches to an upstream component. When the device is closed, the upstream end of the plunger is in alignment with the upstream flange of the body, forming a steamable sterilized in place face and a sterile barrier.
US10247308B2
A sealing device includes an annular seal portion formed of an elastic material. On an inner peripheral surface of the seal portion, a main lip is formed so as to be in slidable contact with an outer peripheral surface of a rotary shaft, and a vacuum space side inclined surface is formed so as to gradually enlarge in diameter from the main lip toward a vacuum space side. On the vacuum space side inclined surface, a plurality of annular projections are formed along an axial direction so as to be in slidable contact with the outer peripheral surface of the rotary shaft in a state where the main lip is in slidable contact with the outer peripheral surface of the rotary shaft.
US10247307B2
Seal assemblies and methods for forming them are described. Aspects of the seal assemblies include a seal ring made of a relative soft material supported by a specially configured backing ring made of a much higher modulus material, such as ferrous and non-ferrous metal or engineered plastic. The seal assemblies may optionally include a retaining ring to prevent slippage relative to the environment or housing in which they are placed and to prevent shuttling. The seal assemblies may also optionally include an energizer to alter the force generating by a sealing lip on the seal ring. The seal assemblies preferably include a rigid hoop ring to minimize shrinkage due to thermal cycling.
US10247306B2
To provide a combined oil control ring comprising a pair of upper and lower side rails and an axially corrugated spacer expander having upper and lower portions for automobile engines, which is capable of keeping an excellent oil-controlling function without sticking between a spacer expander and side rails even in a long period of engine operation, the upper and lower portions of the spacer expander have tabs pushing inner peripheral surfaces of the side rails, projections supporting the side rails, and intermediate portions between the tabs and the projections; and each intermediate portion opposing the side rail has a center-raised bottom having a center-raised shape when viewed along a substantially circumferential direction center-raised shape and a radial direction.
US10247303B2
System and method for calculating vehicle speed and controlling a continuously variable transmission
A system and method for controlling a vehicle having a continuously variable transmission (CVT) comprises a control system having at least one controller, an accelerometer and one or more sensors in communication with the at least one controller to monitor and detect a change in an operational state of the vehicle. The control system determines a vehicle acceleration rate with the accelerometer in response to the change in the operational state of the vehicle. An adjusted vehicle speed is computed based, at least in part, on the vehicle acceleration rate. A variator speed ratio is generated based upon the adjusted vehicle speed and transmitted to the variator assembly of the CVT.
US10247295B1
An exemplary assembly includes a housing including a flange extending from a perimeter of the housing, a cover including an edge tab extending from a perimeter of the cover, a gear set positioned between the housing and the cover, an alignment member positioned between the flange and the edge tab, the alignment member adjacent to an exterior surface of the gear set, and a ring at least partially encircling the housing, the ring including an anti-rotation member and a securing tab. The edge tab and the alignment member are enclosed by the anti-rotation member to maintain a radial position of the gear set.
US10247287B2
A gear has an input shaft and an output shaft, the gear includes the following elements: an outer wheel; an inner wheel which is positioned concentrically in relation to the outer wheel; a traction means extending between the outer wheel and the inner wheel; and a revolving transmitter which lifts the traction means from an outer periphery of the inner wheel and pushes the traction means onto an inner periphery of the outer wheel, the transmitter includes a first transmitter element and a second transmitter element provided on a rotatable transmitter carrier, wherein the first transmitter element and the second transmitter element are rotatable on the transmitter carrier and wherein each transmitter element is provided eccentrically from a rotation axis of the transmitter carrier, the first transmitter element includes a first disk, and the second transmitter element includes a second disk.
US10247279B2
A gearbox for a roller in a spinner wrench is provided. In some embodiments, the gearbox can be disposed internally to the roller and can include a sun and planet type epicyclical gear-reduction assembly. In further embodiments, the gearbox can include a second sun and planet type epicyclical gear-reduction assembly to provide for a second, or final, stage reduction. Some embodiments can provide for reduction-ratios close to 3:1 and can be driven by a relatively small motor. The planet gears can be used to drive an annular gear which can spin the roller. In some embodiments, the gearbox can use high-capacity bearings.
US10247278B2
A Hybrid Orbitless gearbox combines the high speed capabilities of an Orbitless first stage with the high ratio of a Coupled Orbitless second stage. The two stages share a common set of carriers and offset members for high compactness and simplicity. A Coupled Orbitless second stage may also function on its own. Its all-pinion design supports a variety of engaging members that include gears, chains, sprockets, belts, cables and pulleys, among others. Stepped engaging members further amplify the reduction ratio and variable pitch diameter engaging members provide an infinitely variable transmission ratio.
US10247268B2
Provided is a brake device that is able to achieve an improvement in versatility of the device, and which is able to reduce an uncomfortable feeling and annoyance caused by an operating noise of a parking brake. This brake device includes: left and right parking brake mechanisms configured to independently apply braking forces to left and right wheels of a vehicle, respectively, and hold the vehicle stationary; and a control device configured to control these parking brake mechanisms. The control device includes a parking brake actuation determiner configured to adjust respective timings at which the left and right parking brake mechanisms are actuated so as to reduce an uncomfortable feeling caused to an occupant of the vehicle.
US10247266B2
A brake mounting bracket apparatus that includes a rear body and a front body. The rear body includes an inboard tie bar and a pair of legs that each extend from a lower portion at the inboard tie bar to a terminal end. The front body includes an outboard tie bar and a pair of arms that each extend from the outboard tie bar to a distal end. A pair of bridges each extend between one of the legs and one of the arms. A pair of webs each extend outwardly from one of the bridges for providing stiffness to the bridges and for damping vibrations in the mounting bracket apparatus.
US10247262B2
A flywheel is attached to a shaft of a turbine. As the shaft rotates, the flywheel swings outwards away from the shaft and regulates the angular velocity of the rotating shaft. In an embodiment, there are multiple flywheels attached to the shaft. In another embodiment there is a first flywheel that controls a second flywheel. In another embodiment, the flywheel has adjustable or centrifugal displacement of counterbalanced masses for effective rotational diameter with effective rotational balance. In another embodiment, a small pilot centrifugal displacement flywheel may control a clutch by rotational velocity and may include a hysteresis control. An example of a clutch may limit that degree to which the arms of the flywheel may be extended and/or retracted. In another embodiment, a small pilot centrifugal displacement flywheel controls the hysteresis of a centrifugal flywheel displacement.
US10247256B2
A clutch for an automatic transmission includes a clutch pack having a first set of friction disks interleaved with a second set of friction disks. The clutch further includes an annulus having an outer surface connected to the first friction disks and an inner surface. The annulus defines oil holes extending from the inner surface to the outer surface to permit oil to flow from the inner surface to the clutch pack. Air passageways are defined in the annulus and extend through the annulus permitting air to flow from the inner surface to the clutch pack to reduce drag losses between the first and second sets of disks. Each of the air passageways have an entrance that is radially inboard of an entrance of each of the oil holes.
US10247255B2
A hub unit has a brake disc and a hub body disposed to rotate with a rim on which a tire is mounted. An internal space is formed in the hub body, wherein the brake disc is fixed in the internal space. A fixed shaft is disposed and fixed along a rotation center shaft of the hub body. A brake shoe is coupled to the fixed shaft. A brake pad is disposed to contact the brake disc. A braking force applier supplies a braking force to the hub body wherein the brake pad and the brake disc are in contact with each other.
US10247253B2
Embodiments of the present invention relate to a component group with a friction device with at least two components that are rotatable relative to one another, in particular for actuating a clutch of a vehicle, wherein a coil spring influencing the degree of efficiency, the friction is disposed between the components that are rotatable relative to one another and wherein the component group with a friction device is integrated in a transmission or an actuator, or both.
US10247247B2
A spline connection structure includes a shaft portion having teeth with crowned tooth surfaces formed at equal intervals on an outer circumferential surface and a cylindrical portion having grooves into which the teeth of the shaft portion are fitted formed on an inner circumferential surface are connected. Two adjacent tooth surfaces facing each other are bent while maintaining a constant distance therebetween in a tooth width direction when viewed from a diameter direction of the shaft portion.
US10247245B2
A halfshaft assembly in a vehicle is disclosed. The halfshaft assembly includes a hub and a mating universal joint, such as a constant-velocity joint. The hub has a plurality of hub-teeth arranged annularly about an axis. The constant-velocity joint has a plurality of joint-teeth arranged annularly about the axis and engaged with the hub-teeth. Between each joint-tooth is a joint-root. The top, outermost surface of each tooth facing away from adjacent roots extends at a first angle with respect to the central axis. The root extends at a second angle with respect to the central axis. The angles are different such that the height of the tooth varies along the same tooth along the length of the tooth. Each tooth has involute side surfaces. The joint-teeth form a conical or inverse-conical shape.
US10247232B2
A rolling-element bearing cage or segment configured to guide at least one rolling element includes a first circumferential ring connected to a second circumferential ring by a plurality of axially extending bridges. A first one of the bridges includes a first axial portion that has a cross-section perpendicular to the axial direction and a cross sectional area and a peripheral length. The peripheral length of the cross section of the first axial portion is greater than a peripheral length of a smallest rectangle bounding the cross section.
US10247228B2
A ball joint assembly includes a housing at least partially defining a cavity. A ball stud includes a head portion positioned within the cavity and a shaft extending from the head portion. A ball race having an inner surface is positioned within the cavity to define an interface between the inner surface of the ball race and an outer surface of the head portion. A solid friction coating is positioned within the interface. The solid friction coating is coupled to the inner surface of the ball race and/or the outer surface of the head portion of the ball stud. A piston can also be positioned within the cavity, wherein at least one gap is defined between the ball race and the piston and/or between the ball race and the housing. Methods of assembling a ball joint assembly are also disclosed.
US10247227B2
A component for the transmission and absorption of mechanical forces and moments includes at least one dimensionally stable component element having at least one hollow-profiled section extending along a longitudinal axis of the dimensionally stable component element, and at least one hollow-profiled component element consisting of fiber-reinforced plastic extending along a longitudinal axis of the hollow-profiled component element. The hollow-profiled component element is partially received by the hollow-profiled section of the dimensionally stable component element in a form-fitting manner. The component is produced by a method that includes the steps of inserting one end of the one hollow-profiled component element into the hollow-profiled section of the dimensionally stable component element and pressing the outer circumference (26) of the hollow-profiled component element (16) against the inner circumference (24) of the hollow-profiled section (14) by an inflatable element.
US10247225B2
A device for producing a functional shaft and a functional shaft are provided in which a functional element which is provided with a pocket is inserted into a retaining element, a shaft is inserted into the pocket, and a force applied to the functional element while the shaft is being inserted into the pocket is measured.
US10247205B2
A method of charging a hydro-pneumatic energy storage system is described. The system has a first hydro-pneumatic accumulator with a first hollow vessel. Disposed within the first hollow vessel is a first compressible volume containing a first amount of gas. The system has a second hydro-pneumatic accumulator with a second hollow vessel. Disposed within the second hollow vessel is a second compressible volume containing a second amount of gas. The gas contained in the first volume is pre-pressurized to a first hydrostatic pre-charge pressure and the gas contained in the second volume is pre-pressurized to a second hydrostatic pre-charge pressure. The second pre-charge pressure is higher than the first pre-charge pressure. In addition, the gas in the first volume is pressurized by discharging a non-compressible hydraulic fluid into the first vessel while keeping a quantity of non-compressible hydraulic fluid contained in the second vessel constant to keep the pressure of the gas contained in the second volume at the second pre-charge pressure.
US10247203B2
A noise reduction structure includes a compressor discharge-side pipe portion, a first porous plate having a plurality of through holes and extending circumferentially along an inner circumferential surface of the compressor discharge-side pipe portion so that an air layer is formed between the first porous plate and the inner circumferential surface, a partition dividing an interior of the compressor discharge-side pipe portion in a radial direction in a circumferential direction of the compressor discharge-side pipe portion so as to form a plurality of flow paths in the compressor discharge-side pipe portion, and a second porous plate having a plurality of through holes. The second porous plate is provided in each of the plurality of flow paths and extends along the partition so that an air layer is formed between the second porous plate and the partition.
US10247191B2
A combination axial fan and LED lighting system configured to fit into the footprint of a standard ceiling tile. The system includes a housing container and an axial fan. The fan has a fan cavity including air diversion mechanism to direct air from the fan cavity toward the lighting and fan components. The invention includes an airflow surface to direct air existing the fan cavity along an LED light fixture.
US10247189B2
A scroll compressor is provided. The scroll compressor may include a fixed scroll having a fixed wrap and a plurality of first key recesses, an orbiting scroll engaged with the fixed scroll to define a compression chambers and having an orbiting wrap and a plurality of second key recesses, the orbiting scroll performing an orbiting motion with respect to the fixed scroll, a drive having a rotation shaft coupled to the orbiting scroll such that one end portion thereof overlaps the orbiting wrap in a lateral direction, and an Oldham ring having a plurality of first and second keys coupled to the plurality of first key recesses and the plurality of second key recesses, respectively. The plurality of second keys may at least temporarily protrude from the plurality of second key recesses in a radial direction during the orbiting motion. Further, the plurality of second key recesses and the plurality of second keys may be disposed to obtain maximum contact areas therebetween at a moment of start of discharging.
US10247185B2
A fluid pump includes a housing; an outlet; an inlet plate within the housing and having an inlet; an outlet plate disposed within the housing and having an outlet plate outlet passage; an electric motor which rotates about an axis; a pumping arrangement rotationally coupled to the electric motor such that rotation of the pumping arrangement causes fluid to be pumped from the inlet to the outlet plate outlet passage and through the outlet; a diverter plate between the outlet plate outlet passage and the electric motor and having a diverter passage which provides fluid communication from the outlet plate outlet passage, past the electric motor, to the outlet, the diverter plate also having an imperforate wall which is axially aligned with the outlet plate outlet passage such that the imperforate wall laterally directs fluid from the outlet passage to the diverter passage.
US10247175B2
A seal assembly for a wax motor or the like provides an elastomeric seal, fitting against an actuator shaft that may slide through the elastomeric seal, where the elastomeric seal has mold flash regions that are displaced from the contact area between the shaft and the elastomeric seal significantly increasing elastomeric seal life.
US10247165B2
A handheld engine-driven working machine comprises an internal combustion engine with a throttle valve, a throttle adjusting device for adjusting an opening degree of the throttle valve of the internal combustion engine, and a control device provided in the internal combustion engine. The control device is configured to detect a rotational speed and an amount of change in the rotational speed at every at least one rotation of the internal combustion engine. The control device determines that the throttle valve is partially opened when the amount of change in the rotational speed is greater than a predetermined value.
US10247163B2
An ignition device for an internal combustion engine is provided which improves ignition while reducing electric power consumption. An ignition device for an internal combustion engine includes an ignition plug that is placed with a tip exposed on an end in an axial direction of a combustion chamber formed in a cylinder and that includes a central electrode and a grounding electrode provided opposing each other at the tip, and a magnetic field former that forms a magnetic field in a direction in which a magnetic field vector substantially vertically passes through an approximate two-dimensional plane including a spark discharge path formed, by a gas flow ejected to the end in the axial direction of the combustion chamber, between the central electrode and the grounding electrode, and extending in an approximate U shape in a direction orthogonal to the opposing direction of the electrodes.
US10247161B2
Provided is a motor generator, which is always connected to an engine via a belt, and is configured to carry out start control of the engine and power generation control, the motor generator having a two-output power transmission mechanism including: a belt driving mechanism, which is configured to drive the engine through the belt; and a gear driving mechanism, which includes a pinion gear to be coupled to a ring gear on the engine side in accordance with an external instruction, and is configured to drive the engine by the pinion gear being coupled to the ring gear, in which an output of the belt driving mechanism and an output of the gear driving mechanism are arranged at positions opposing each other in an axial direction of a rotor of the motor generator.
US10247158B2
A fuel injection valve includes a valve seat 15b and a valve body 27c that cooperate with each other to open and close a fuel passage, a movable element 27 that has the valve body 27c provided at one end thereof and has a fuel passage formed therein, a valve seat member 15 having the valve seat 15b formed thereon, an upstream-side communication hole 27boa that is located upstream of the flow of fuel and connects the inside and outside of the movable element 27, and a downstream-side communication hole 27bob that is located downstream of the flow of fuel and connects the inside and outside of the movable element, in which a guide section for the valve body 27c, where the valve seat member 15 and the valve body 27c are in sliding contact with each other, is provided downstream of the downstream-side communication hole 27bob and in which a fuel passage 17h for connecting in the center axis direction the upstream side and downstream side of the guide section is provided at the same angular position in the circumferential direction of the movable element 27 as the downstream-side communication hole 27bob. With this arrangement, even if a foreign thing is accidently mixed into the fuel passage during the production process, the foreign thing can be removed with a shorter running-in operation time.
US10247146B2
A solenoid valve device according to an aspect of an embodiment includes a solenoid valve, a determination unit, a setting unit, and a correction setting unit. The solenoid valve is provided on a fluid channel with a fluid passing there through and adjusts a flow rate of the fluid. The determination unit determines a target degree of valve opening of the solenoid valve. The setting unit sets a driving signal for driving the solenoid valve in such a manner that a degree of valve opening of the solenoid valve is the target degree of valve opening. The correction setting unit sets a differential pressure correction signal for driving the solenoid valve in accordance with a differential pressure on the fluid channel between a front and a back of the solenoid valve.
US10247139B2
A gas generator includes an outer propellant, an inner propellant arranged inside the outer propellant, and a barrier membrane which isolates the outer propellant from the inner propellant. A forward end surface of the inner propellant faces a combustion space. A side surface of the inner propellant is isolated from the combustion space.
US10247136B2
A thrust reverser system for incorporation into a nacelle assembly of a gas turbine engine includes a frame member and a forward ring movable along an axial centerline relative to the frame member. The forward ring is movable between a first position and the second position. The thrust reverser system additionally includes a cascade segment slidably attached to the frame member and rotatably attached to the forward ring. When the forward ring is in the first position the cascade segment is in a radially outer position, and when the forward ring is in the second position, the cascade segment is in a radially inner position for changing a direction of a flow of air to generate reverse thrust.
US10247133B2
A piston with a cooling gallery containing an open cell radiator is provided. The radiator has a large thermally conductive surface area that acts as a heat-sink to remove heat from the piston. Heat from the piston is transmitted from the radiator to cooling oil that enters the cooling gallery via an oil inlet formed in a floor of the cooling gallery and exits the cooling gallery via an oil outlet. The piston comprises a piston body including an upper part presenting an upper combustion surface and an undercrown surface. A ring belt depends from the upper combustion surface, and the cooling gallery extends around the piston body beneath the undercrown surface radially inwardly of the ring belt. The radiator includes a plurality of fins extending annularly around the cooling gallery. The fins of the radiator are spaced from one another by gaps extending annularly around the cooling gallery.
US10247128B2
A cylinder for a V-twin engine includes a section of steel tubing cut to a length. The section of steel tubing includes a first portion having a first wall thickness and a second portion having a second wall thickness less than the first wall thickness. The second wall thickness is less than 0.050 inch. The section of steel tubing includes a first ribbing pattern on an outer surface, within the first portion, and a second ribbing pattern including multiple ribs formed on individual ribs of the first ribbing pattern. A cast body is provided on the first portion of the section of steel tubing so that the section of steel tubing is fixedly secured within the body to form a cylinder sleeve defining a cylinder bore. The second portion having the second wall thickness extends from an end of the body to be received within a bore of a crankcase.
US10247123B2
A vehicle has an engine, a CVT and at least one ground engaging member. A method of controlling the engine includes the steps of: determining an idle speed set point based at least in part on a first speed proportional to a driven pulley speed, the idle speed set point being less than an engagement speed when the driven pulley speed is less than a predetermined driven pulley speed and being less than an actual engine speed when the driven pulley speed is greater than the predetermined driven pulley speed; and controlling the engine to operate under conditions corresponding to the idle speed set point when a desired engine speed is less than the idle speed set point. Controlling the engine to operate under conditions corresponding to the idle speed set point causes engine braking when the driven pulley speed is greater than the predetermined driven pulley speed.
US10247122B1
An engine control system is structured for operating a turbocharged engine system and includes an electronic control unit. The electronic control unit is structured to switch the engine system from operation in a parasitically loaded mode where fuel pressurized by a fuel pump is dumped to a low pressure space, to operation in a second mode, where an engine load increase is detected. Turbocharger lag in the engine system is limited during increasing the engine load by way of exhaust energy produced in response to the parasitic loading. Related methodology is disclosed.
US10247118B2
A control apparatus for an internal combustion engine that includes an EGR channel and an EGR valve is configured, when the internal combustion engine is in a warm-up process and when an intake air flow rate that is a flow rate of air supplied to the internal combustion engine main body is less than or equal to a predetermined value, to open the EGR valve with a minute opening degree that is an opening degree smaller than a minimum opening degree of the EGR valve with which a condensed water in an exhaust-channel-side portion that is a portion of the EGR channel on a side closer to the exhaust channel relative to the EGR valve flows into an intake-channel-side portion that is a portion of the EGR channel on a side closer to the intake channel relative to the EGR valve.
US10247103B2
The present disclosure is directed to an assembly tool kit for a bundled tube fuel nozzle assembly. The assembly tool kit includes a plurality of pins. Each pin includes a shaft portion, a tapered portion coupled to a first end of the shaft portion, and a contoured portion coupled to a second end of the shaft portion. The contoured portion includes a cylindrical section and a frustoconical section. The tapered and shaft portions of each of the plurality of pins are positioned within a passage defined by one of a plurality of tubes forming a portion of a bundled tube fuel nozzle assembly. The contoured portion of each of the plurality of pins is positioned in one of a plurality of cap plate apertures. Each of the plurality of pins radially aligns one of the plurality of cap plate apertures with a corresponding tube of the plurality of tubes.
US10247094B2
A turbocharged natural-gas engine comprises a first drive system (201), a second drive system (202), a third drive system (203) and a fourth drive system (204). The first drive system (201) comprises a gas storage cylinder (72), an eighth motor (65), an axial flow compressor (68), a combustion chamber (71), a first safety device (69), a second safety device (79), an electric ignition device (54), a third drive device (96), a nozzle (102), a turbine (205), a turboshaft (206) and a ninth bracket (70). The gas storage cylinder, the eighth motor, the axial flow compressor, the combustion chamber, the first safety device, the second safety device, the first lever braking device, an electric ignition device, the third drive device and a nozzle are arranged on the ninth bracket; the eighth motor is connected with the axial flow compressor, and the axial flow compressor is driven by the eighth motor.
US10247089B1
A power train system includes a heat exchanger reservoir to collect condensate, a layered intake manifold, and integral tubing leading from the reservoir to an interior of the intake manifold via an intake manifold wall such that there is no seal between the condensate port and the manifold. The tubing splits into at least two branches transitioning into a set of wings containing a plurality of nozzles protruding into the interior.
US10247077B2
A retention material for a gas processing device including a processing structure and a casing for accommodating the processing structure, the retention material including inorganic fibers and being arranged between the processing structure and the casing, wherein in a test of repeating a cycle of compressing the retention material until a bulk density of the retention material becomes a prescribed compression bulk density, followed by retaining for 10 seconds, and then releasing until a bulk density of the retention material becomes a release bulk density that is smaller by 12% of said prescribed compression bulk density; a release surface pressure of the retention material after repeating the cycle 2500 times and the compression bulk density of the retention material satisfies the relationship, P≥17.10×D−1.62 wherein P is the release surface pressure (N/cm2) and D is the compression bulk density (g/cm3).
US10247073B2
An exhaust system for a combustion engine includes first and second catalytic converters arranged downstream of the combustion engine in a flow direction of exhaust gas. First and second exhaust pipes extend from the combustion engine to the first and second catalytic converters, respectively, with a first valve disposed in the first exhaust pipe, and a second valve disposed in the second exhaust pipe. The first and second valves operate such that in the presence of an exhaust temperature which is equal to or less than a limit value, at least the first valve opens to allow exhaust gas from the combustion engine to flow through the first catalytic converter, and that the first valve closes and the second valve opens, when the exhaust temperature is greater than the limit value to thereby allow exhaust gas from the combustion engine to flow through the second catalytic converter.
US10247070B2
An aftertreatment system comprises a SCR system including a catalyst formulated to decompose constituents of an exhaust gas passing therethrough. A filter is positioned upstream of the SCR system. The filter comprises a sulfur suppressing compound formulated to reduce an amount of SOx gases included in the exhaust gas flowing through the aftertreatment system. In particular embodiments, the filter comprises a filter housing and a filter element positioned within the filter housing. The filter element comprises the sulfur suppressing compound.
US10247065B2
A two-cycle internal combustion engine with rear compression chamber, other than that of a crank case. This present engine has valves that can be screwed on the engine block near top dead center, and is actuated by air pressure. This present two-cycle engine uses an oil sump similar to that of a four-cycle engine, which eliminates the need to premix oil with the fuel. This present engine has a stationary piston which operates within a movable piston to form a rear-compression chamber. The movable piston has ports near its crown to transfer charge to the combustion chamber. The movable piston also has ports near bottom of its skirt to allow the fuel and air mixture to enter the rear compression chamber. This engine has a piston seat which is adapted to connect the movable piston to the connecting rod.
US10247057B2
A vane-type, hydraulic cam shaft adjuster (1, 20) having a stator (2) and a rotor that is rotatably mounted in relation to the stator (2), wherein at least one locking bolt (10) is provided in order to limit the rotor in relation to the stator (2), in at least one direction of rotation, when the locking bolt is brought into contact with a slot guide (12) of an insert part (4, 21), wherein the insert part (4, 21) is secured in a component (2) that is secured to the stator, wherein the insert part has securing regions, between which securing regions and the component (2) that is secured to the stator there is frictional connection, and wherein the insert part (4, 21) is formed, in terms of material and geometrics, in such a way that a deformation (19) causes a change in length (18) of the insert part (4, 21), involving the friction connection.
US10247039B2
The invention relates to an assembly which includes: two rotationally symmetrical components (10, 20) for supporting the blades of a turbine engine, arranged one inside the other concentrically about a turbine engine axis, and a system (30) for locking the components (10, 20) such as to prevent the relative translation of same in the axial and radial directions relative to said axis, the system including a slotted ring (40) comprising a U-shaped cross-section suitable for receiving one end of the components (10, 20), the assembly being characterized in that the ring (40) and one of the components (10, 20) are shaped such as to allow the ring to be interlocked on the component, and in that the locking system (30) also includes a member for stopping the rotation of the ring relative to the component with which the latter is interlocked. The invention further relates to a method for assembling such an assembly.
US10247035B2
A spoke locking arrangement comprising a washer seated in a seat defined in a structural ring of a gas turbine engine, the washer having a portion thereof plastically deformed into an anti-rotation notch defined in the structural ring, thereby locking the washer against rotation in the seat, the washer further comprising a set of holes for receiving corresponding bolts, and wherein the washer further has at least one anti-rotation tab at each hole, the anti-rotation tabs being deformable in engagement with the bolts to individually lock the same against rotation.
US10247029B2
A gas turbine engine, system, and method with clearance control are provided. For example, the gas turbine engine includes a static component, and a rotating component that shifts axially in one of an aft direction and a forward direction in relation to the static component during a first operating condition of the gas turbine engine, and shifts axially in the other of the aft direction and the forward direction in relation to the static component during a second operating condition of the gas turbine engine. The first operating condition is when a rotating component growth and a static component growth change at different rates. The second operating condition is when the rotating component growth and static component growth normalize.
US10247024B2
The present disclosure relates to a turbomachine that includes a first component and a second component coupled to another and a seal assembly between the two components. The seal assembly may include an upstream corner shim and a downstream corner shim, where one of the upstream corner shim or the downstream corner shim includes a pressure actuation feature configured to block a flow of gas between the two components.
US10247019B2
Flow path assemblies and methods for assembling a flow path assembly of a gas turbine engine are provided. For example, a flow path assembly comprises a unitary outer wall including combustor and turbine portions that are integrally formed as a single unitary structure; a single piece, generally annular inner band; and a plurality of nozzle airfoils extending from the unitary outer wall to the inner band. Each nozzle airfoil interfaces with the inner band to position the inner band within the assembly. An exemplary assembly method comprises inserting an inner band into a flow path having a unitary outer wall as its outer boundary; inserting a plurality of nozzle airfoils into the flow path; and securing the nozzle airfoils with respect to the unitary outer wall. The inner band interfaces with an inner end of each nozzle airfoil to radially locate the inner band within the flow path.
US10247018B2
A disclosed fan section of a gas turbine engine includes a fan rotor having a plurality of fan blades and a duct defining a passageway aft of the fan rotor. A fan exit guide vane is disposed within the duct downstream of the fan blades. The fan exit guide vane includes a plurality of exit guide vanes positioned downstream of the fan rotor with at least two of the plurality of exit guide vanes including different aft geometries for guiding airflow through the passage to reduce pressure distortions at the fan blades.
US10247012B2
An aerofoil blade or vane for the turbine of a gas turbine engine includes: an aerofoil leading edge; an aerofoil trailing edge; an aerofoil suction side; and at least one reverse-pass coolant passage, extending within the aerofoil blade or vane; wherein the at least one reverse-pass coolant passage includes a substantial reverse-pass portion in which, in use, coolant flows in a direction away from the trailing edge and towards the leading edge.
US10247004B2
A heat exchanger has a first plurality of fluid passages with an inlet manifold communicating into a core portion, and then an outlet manifold. A second plurality of fluid passages has an inlet manifold communicating into a core portion, and then into an outlet manifold and the core portions of both the first and second pluralities of fluid passages having smaller cross-sectional areas than cross-sectional areas of the inlet and outlet manifolds. A gas turbine engine and a method of forming a heat exchanger are also disclosed.
US10246990B2
A probe for a trenchless guide instrument includes an antenna, a control circuit board and at least one battery supplies power to the control circuit board; one battery is disposed inside the battery region; the control circuit board is disposed inside the electronic region; a first insulating pipe is disposed inside the antenna and outside the battery, the antenna further includes a magnetic core, and a coil winds around the magnetic cores and one end of the coil is connected to the control circuit board; the magnetic core further includes magnetic core units, each magnetic core unit is made from magnetic material, the magnetic core units are positioned on a peripheral surface of the first insulating pipe, and are insulated from each other.
US10246989B2
A sensor arrangement using an optical fiber and methodologies for performing an analysis of a subterranean formation, such as a subterranean formation containing a hydrocarbon based fluid. The sensor arrangement may be used to measure one or more physical parameters, such as temperature and/or pressure, at a multiplicity of locations in the subterranean reservoir. The sensor arrangement may comprise a sensor array comprising an elongated outer casing for insertion in the subterranean formation and into a fluid in the subterranean formation. The sensor array may comprise an optical fiber defining an optical path that links one or more temperature sensors and one or more pressure sensors and transports measurement data generated by the temperature and pressure sensors. A data processing system may be connected to the sensor array to receive measurements from the sensor array and to compute one or more values of a property of an extraction installation operating on the subterranean formation.
US10246988B2
Described is a system for position estimation. A set of raw sensor outputs are acquired from a sensor of a platform. The set of raw sensor outputs are stored in non-transitory memory. A set of optimized sensor measurements is generated by deducing errors in the raw sensor outputs using an unconstrained optimization algorithm. The system determines a position of the platform based on the set of optimized sensor measurements.
US10246987B2
Methods and assemblies that can be used to orient a second pipe with respect to a first pipe in a wellbore are disclosed. The first pipe may be a casing string that includes one or more recessed latch couplings, and the second pipe may be a tubing string that includes one more complementary radially extendable latch keys that may be received within the latch couplings. The tubing string may include one or more switches associated with the latch keys that are actuated when the latch keys are received within the latch couplings. The actuation of the switches is communicated to an operator at the surface via control lines within the tubing string.
US10246983B2
A method for the subsea transport of a multi-phase production fluid from a wellhead to a point remote from the wellhead, the multi-phase production fluid comprising a water phase, an oil phase and a gas phase. The method includes introducing the multi-phase production fluid into a pipeline, the pipeline extending from proximate the wellhead to a point remote from the wellhead; imparting rotational motion to the multi-phase production fluid; wherein the rotational motion of the multi-phase production fluid separates the water phase from the oil phase and the gas phase and reduces the pressure drop along the pipeline. A system for the subsea transport of a multi-phase production fluid from a wellhead to a point remote from the wellhead and a method for reducing hydrate formation during the subsea transport of a multi-phase production fluid from a wellhead to a point remote from the wellhead are also provided.
US10246982B2
In disclosed explosive units for use in a wellbore, the casing can include a tubular outer body comprising grooves, pockets, or other variances in thickness that create stress concentrations that promote shear and tensile fragmentation instead of ductile expansion of the casing, which can negatively impact permeability of a wellbore. In other embodiments, the casing can comprise non-ductile and/or reactive material which responds to explosive or high temperature loading by brittle failure, disintegration, melting, burning, and/or chemically reacting with the energetic materials and/or the borehole environment. Such embodiments can enhance the permeability of the wellbore after detonation.
US10246974B2
A technique facilitates efficient punching and cutting of a tubing with a single trip downhole. A cutter and a puncher are combined and conveyed together downhole into a borehole, e.g. a wellbore. The cutter and puncher may be conveyed downhole via a suitable well string. A communications line may be routed to both the cutter and the puncher to enable selective actuation of the cutter and the puncher. For example, the puncher may initially be actuated by detonating a shaped charge to perforate through the tubing in the borehole. Subsequently, the cutter may be operated to sever the tubing. In some applications, the cutter may be replaced with another tool operatively coupled with the communications line.
US10246972B2
In-riser power generation devices and methods are utilized to generate power subsea to operate subsea devices of a subsea well system. A turbine power generator is located in fluid communication with a subsea fluid flow path of a subsea well system and the turbine power generator is operationally connected to a subsea power device.
US10246970B2
A landing string includes a valve having a valve member mounted within a flow path extending through the landing string, and a valve control system for use in operating the valve to move the valve member between open and closed positions to control flow along the flow path. The valve control system is reconfigurable between a first configuration in which the valve is operated or controlled under a fail-as-is (FAI) mode of operation, and a second configuration in which the valve is operated or controlled under a fail-close (FC) mode of operation.
US10246968B2
A method for cementing a tubular string into a wellbore includes: running the tubular string into the wellbore using a workstring having a deployment assembly; delivering an opener activator through the workstring to the deployment assembly, thereby launching an opener plug from the deployment assembly; pumping the opener activator and plug to a stage valve of the tubular string, thereby opening the stage valve; pumping cement slurry into the workstring; pumping a closer activator through the workstring behind the cement slurry, thereby launching a closer plug from the deployment assembly; and pumping the closer activator and plug to the open stage valve, thereby driving the cement slurry into an annulus between the tubular string and the wellbore and closing the stage valve.
US10246965B2
In one embodiment, a ball release system for use in a wellbore includes a tubular housing, a seat disposed in the housing and comprising arcuate segments arranged to form a ring, each segment radially movable between a catch position for receiving a ball and a release position, a cam disposed in the housing, longitudinally movable relative thereto, and operable to move the seat segments between the positions, an actuator operable to move the cam, and an electronics package disposed in the housing and in communication with the actuator for operating the actuator in response to receiving a command signal.
US10246960B2
A system for deploying a power cable within a coiled tubing includes a power cable operable to power an electrical submersible pump, the power cable extendable through a coiled tubing. A plurality of anchor assemblies are spaced along a length of the power cable, each of the anchor assemblies secured to the power cable and having a gripping element. The gripping element is moveable between a retracted position and an extended position in response to an applied stimuli, wherein the gripping element is sized to engage an inner diameter surface of the coiled tubing when the gripping element is in the extended position.
US10246958B2
A valve assembly for use controlling flow of fluid into a drill pipe, the valve assembly having a valve body, a valve member and a valve seat, wherein a) the valve body has a main passage b) the valve member is movable between a closed position in which the valve member engages with a seat face of the valve seat to substantially prevent flow of fluid along the main passage, and an open position in which the valve member is spaced from the seat face, c) the valve seat is a separate part to the valve body.
US10246957B2
A disclosed embodiment of a downhole tool includes a pump that is powered by rotation of the drill string to increase fluid pressure during downhole circulation.
US10246953B2
A system for disassembling components of a drill string includes a primary wrench, a secondary wrench, and a bit removal basket. The primary wrench has a pair of jaws in which at least one of the jaws is moveable in relation to the other. The secondary wrench is disposed at a position lower than the primary wrench and is configured to define a pair of beveled faces that are adapted to restrict a rotational movement of at least one component of the drill string. The bit removal basket is disposed at a position lower than the secondary wrench. The bit removal basket is configured to define an opening therethrough. A shape of the opening is configured to correspond with profiles of at least two types of drill bits, one of the at least two types of drill bits being present for use in the drill string.
US10246948B2
A process for treating a pin having an external threaded portion and a box having an internal threaded portion wherein the process provides a threadable joint having a high galling resistance. One embodiment of the present invention includes applying a lubricant on the threaded portion of at least one of the pin and box. The threadable joint is made up by threadably engaging the threaded portions of the pin and box to a recommended torque according to the American Petroleum Institute and then breaking out the threaded joint. The making up and breaking out step with lubricant applied on the threaded portion of at least one of the pin and box is performed a plurality of times. One of the threaded portions of the pin and box is then case hardened. The threadable joint made from this process is highly resistant to galling without the requirement of any lubricant.
US10246945B2
An earth-boring tool comprises a body having a face at a leading end thereof, blades extending from the body and comprising primary blades and secondary blades, and cutting elements on the blades and arranged in groups each comprising neighboring cutting elements. Some of the groups are disposed only on the primary blades in a first spiral configuration. Others of the groups disposed only on the secondary blades in a second, opposing spiral configuration. Methods of forming an earth-boring tool, and methods of forming a borehole in a subterranean formation are also described.
US10246934B2
A door for attenuating sound includes at least one core disposed between a front surface and a back surface. The at least one core includes a composition comprising vermiculite, for example, expanded vermiculite, and an inorganic bonding agent. Such a composition for the core has a density of at least 600 Kg/m3. The door has at least a sound transmission class (STC) rating or an outdoors/indoors transmission coefficient (OITC) being higher than 30.
US10246931B2
A sliding window assembly including a window frame and at least three panes disposed within the window frame in offset vertical planes. The panes are arranged for sliding movement together upwardly within the window frame or together downwardly within the window frame. One or more of the panes can be fixed. The panes have a fully open position and a fully closed position. In the closed position, respective edges of the panes overlap while in the open position, the entire panes overlap. The panes can be connected to a counterweight arrangement by a pulley arrangement, which includes a vertically movable balancing weight that is equal to the weight of the panes, or the panes can be connected together to counterbalance each other.
US10246926B2
A driver for a movable window pane, in particular of a motor vehicle, having a receptacle recess, a receptacle of an edge section of the window pane, and having an elastically displaceable detent lug which is designed to engage in a latching cutout of the window pane in order to arrest the window pane on the driver, wherein the detent lug, in the reset position thereof, obstructs the receptacle recess and has an insertion taper assigned to the receptacle recess such that the detent lug is displaced into a position releasing the receptacle recess by insertion of the window pane into the receptacle recess. The detent lug has a catch groove on the insertion taper which extends parallel to the receptacle recess over the detent lug.
US10246925B2
A sash lifter assembly for a casement to equalize the amount of reveal at the top and bottom of the casement window sash, and that is also adjustable to accommodate manufacturing tolerances. The sash lifter raises the entire sash up to equalize the reveal at the top and bottom of the window. It is adjustable to accommodate the variation in reveal due to manufacturing tolerances.
US10246918B2
A door hinge (1) or window hinge (1) having two hinge parts (2,4) which are operatively connected to one another so as to be rotatable about a common hinge axis (2), wherein at least one door-or-window-side first hinge part (3) has a plate-like portion (8) which interacts in a fixedly and releasably connectable manner with a holding piece (9) which can be inserted into a groove in the end side of the door or window, wherein the plate-like portion (8) is oriented in an imaginary plane running parallel to the hinge axis (2) and is adjustable with respect to the holding piece (9) in an imaginary plane running at a right angle to the plane of the plate-like portion (8), and wherein an adjustment screw (11) can be screwed into at least one thread (1) of the holding piece (9). Provision is made for a head (12) of the adjustment screw (11) to be arranged between an intermediate piece (14) and the plate-like portion (8) by a clamping device (5) which applies to force to the plate-like portion (8) and the intermediate piece from opposite side and thus hold them together.
US10246913B2
A vehicle door lock device includes: a latch mechanism configured to enable a vehicle door to maintain a closed state in a vehicle body; and a lock mechanism configured to set an unlocked state or a locked state, wherein the lock mechanism includes an inside opening lever connected to an inside door handle, and capable of being operated so as to be rotatable around a lever support portion between an initial position and a maximum operation position, an opening link capable of switching between a first position and a second position, a lock operation lever capable of being operated so as to be rotatable around the lever support portion between an unlocking position and a locking position, and a lever actuating mechanism actuating the inside opening lever toward the initial position.
US10246907B2
The spinning knob includes a shell, a rotation member, and a pushing member. The rotation member is rotatably disposed on the shell. The rotation member includes a threaded portion for screwing with a screw. The pushing member is arranged on the shell and tends to abut against the rotation member to have circumferential interference with the rotation member so that the shell and the rotation member may rotate simultaneously. When the rotation member is screwed to the screw sufficiently and an end of the rotation member abuts against an object, if the shell is further rotated, the rotation member obliquely abuts against the pushing member to make the pushing member trip away from the rotation member so that the pushing member has no circumferential interference with the rotation member and that the shell is rotatable with respect to the rotation member.
US10246903B2
An electronic door lock including a magnetometer, an accelerometer, and a processor. The processor is configured to determine a status of a door with respect to a door frame using data provided by the accelerometer and magnetometer which collectively generate acceleration data, velocity data and positional data of the door. The processor provides data to a user interface or an alert device indicating one or more of: door open angle, prep-less door position, an acceleration alert, a door position alert, door sag, door frame rub, and triangulation of an intruder.
US10246901B2
A vehicle assembly includes a door and a lock. The lock is configured to selectively maintain the door in a closed position. The lock has a receptor arranged on an exterior side of the door. The vehicle assembly additionally includes a physical engagement interface disposed proximate the receptor. The vehicle assembly also includes a cover which is removably coupled to the physical engagement interface. The cover has an interior surface, an exterior surface, and an aperture extending from the exterior surface through the interior surface. When coupled to the engagement interface, the cover inhibits access to the receptor. The vehicle assembly further includes a deflectable retaining member. The deflectable retaining member is configured to deflect from a first position, retaining the cover to the engagement interface, to a second position, releasing the cover from the engagement interface, in response to insertion of a tool into the aperture.
US10246895B2
A robotic swimming pool tile cleaner having a bottom section, an upper section, a fore side, an opposite aft side, a port side and an opposite starboard side, the bottom section having a propeller housing adapted to house a plurality of thrusters being configured to provide forward thrust to the robotic tile cleaner, assist in turning the robotic tile cleaner in a corner of a swimming pool by providing a turning thrust to move the fore side of the robotic tile cleaner away from a swimming pool wall facing the fore side, and to provide side thrust to push the robotic tile cleaner against a swimming pool tile wall facing the port side, and a plurality of cleaning brushes mounted vertically on the port side of the upper section and being configured to touch the swimming pool tile wall and to move during operation of the robotic tile cleaner.
US10246893B2
An apparatus for repairing a fluid leak, thru a crack within the body of a pool return fitting, or in a pipe of close proximity to a pool return fitting, wherein an apparatus comprising of two specially shaped cylindrical flow-thru rubber plugs, wherein a threaded tube thru the center of the rubber plugs, being separated by a spacer sealed with rubber washers and rigid washers, are retained at one end by a flare in said tube, and threaded on the other end, secured by a locking nut over a rigid washer against a conical wedge. When the locking nut is tightened, the rubber plugs radially expands within the return line pipe and the pool return fitting, sealing any leak occurring between the pool return fitting and the return line pipe, wherein fluid may still pass thru the center tube. A return eyeball cap is threaded onto the center tube, wherein the eyeball is threaded female internally. The apparatus may be installed in a pool with or without water in the pool.
US10246885B2
A grouting pan assembly includes a reinforcement ring. In another aspect, a grouting pan includes a substantially planar bottom surface and a curved sidewall surrounding the bottom surface. In a further embodiment, a grouting pan assembly includes a grouting pan having a post or mechanical fastener extending from a backside thereof for attachment to a reinforcing ring or layer.
US10246884B2
A flooring substrate system of polymer, open cell structural panels that may be attached to framing members beneath or placed atop of a waterproof membrane roof or deck structure. The panels are attached by a clip with a mechanical fastener that can be screwed into the lower framing members at a range of angles relative to the plane of the panel while the mechanical fastener and clip remain in complete mating engagement. The panels may also be operationally positioned using a disk that either has a threaded post that is bolted to the panel through a pin block and washer, a fixed pin or a pair of spring arms that lock onto rabbets in the panel's top face.
US10246879B2
Solar reflective roofing granules include a binder and inert mineral particles, with solar reflective particles dispersed in the binder. An agglomeration process preferentially disposes the solar reflective particles at a desired depth within or beneath the surface of the granules.
US10246856B2
The present invention relates to a fixing device for fixing a wear or protection element on a bucket of an earth moving machine, comprising: a base with a housing with a front wall and a rear wall with a through hole, a stop with a lower part housed in the housing, a screw having a head going through the hole and having an end thereof fixed to the stop and a partially compressed elastic device arranged between the screw and the hole. When the elastic device is fully compressed it has a length of L0. In a mounted position, the stop has a front face opposite the front wall, where the distance between both is D1 and the distance between the head and the hole has a value of D2, and the condition of D2−L0>D1 is met in the mounted position.
US10246855B2
A material handling machine can be operated in a bucket shake control mode to override proportional control of a valve controlling fluid flow to and from a bucket tilt cylinder of the machine. Fluid flow through the valve upon actuation of a tilt controller such a joystick therefore is proportional to actuator stroke when the shake control system is deactivated and is always maximized regardless of actuator stroke when the shake control system is activated. Bucket shake control is activated through the manual operation of a control device such as a joystick-mounted switch. As a result of this arrangement, proportional control valve actuation always occurs immediately upon bucket tilt controller movement in a direction that is dependent upon a direction of bucket tilt controller movement from the neutral position thereof.
US10246846B2
An interconnectable hollow metal pipe for the construction of force driven piles is described. A pipe connector is permanently secured to one of opposed open transverse ends of the hollow metal pipe for interconnecting like pipes together. The pipe connector has an inner fitment section for engagement in the one of opposed open end and a protruding pipe connecting section for tight sliding fit connection in the other hollow open end of another interconnectable hollow metal pipe. The pipe connector has securement formations which in combination with the pipe open end, to which it is connected to, forms at least two spaced-apart weld cavities with an outer surface of the pipe to receive therein a recessed weld which does not exceed the pipe outer surface to provide an unobstructed pile outer surface by two or more of the interconnectable hollow metal pipes interconnected end-to-end by the connectors.
US10246841B2
A system for aeration and separation of contaminants from flowing water in a channel, comprising: a wall (1) partially embedded in the channel of flowing water; a mesh (4) placed above the wall (1); a plurality of baffles (3, 5) partially embedded in the channel and placed opposite to each other in such manner so as to the increase the distance travelled by water; plants algae planted around and on the baffles (3, 5); a flooring (6) sloping towards flowing water direction; a sink (2) constructed at a depth lower than the flooring (6); and a water wheel (11) placed in flowing water.
US10246839B2
The present invention generally relates to an apparatus for traffic control and safety. More particularly, the present invention provides a platform adapted to support a flagman and optionally a pole mounted sign to control the flow of traffic near road construction or other similar sites.
US10246837B2
A portable apparatus and method for cutting linear trenches in a concrete ground surface includes two bars extending in parallel spaced relation along the concrete with an elongated track removably fastened and extending orthogonally thereto. A trolley supporting a motor-driven cutting wheel is movably engaged with the track. A depth adjuster alternately lowers and raises the cutting wheel to engage and disengage the concrete while the trolley follows contours of the concrete to cut a kerf of uniform depth. The track is selectively movable to spaced locations along the lengths of the two bars to cut a first plurality of parallel kerfs in a first direction. The apparatus is rotatable about a vertical axis to cut a second plurality of parallel kerfs oriented in a second direction at a predetermined angle, e.g., 90 degrees, to the first direction, to form a simulated tile pattern in the concrete.
US10246834B1
A screed assembly for a paving machine, the screed assembly includes a screed frame, a screed plate attached to the screed frame, a wear plate attached to the screed frame, a tamper bar mounted to the screed frame and configured for up and down reciprocating motion relative to the screed frame, and an eccentric drive mechanism mounted on the screed frame and configured for driving the tamper bar up and down in a reciprocating manner relative to the screed frame. A bottom portion of the tamper bar is configured to slide along the wear plate, which is attached to the screed frame in between the screed frame and the reciprocating tamper bar. The tamper bar includes at least two intersecting chamfered surfaces with different angles from each other and relative to the screed plate at a leading edge of the tamper bar facing in a direction of travel of the paving machine as the paving machine is applying paving material to a surface.
US10246833B2
An asphalt paving machine includes a drive system, an asphalt receiving hopper and a distributing auger. A hopper conveyor, which is adapted to transport asphalt paving material from the receiving hopper to the distributing auger, includes a hopper conveyor motor and a speed sensor. A vertically-adjustable flow gate defines the size of the gate opening from the asphalt receiving hopper to the distributing auger, and a flow gate position sensor is adapted to determine the vertical position of the flow gate. A controller includes a timer and is operatively connected to the drive system for the paving machine, the speed sensor for the hopper conveyor motor and the flow gate position sensor. The controller uses a machine speed signal, a conveyor speed signal and a flow gate signal to measure the amount of asphalt paving material delivered to the distributing auger per unit of time.
US10246828B2
Sanitary tissue products employing fibrous structures that exhibit a novel combination of compressibility properties, plate stiffness properties, and slip stick coefficient of friction properties, and methods for making same.
US10246820B2
Provided are novel compounds of indigo-derivatives as irreversible color changeable dyes. Also provided are methods for the use of various indigo-derivatives for irreversibly color changeable dyes for textile materials and to novel compounds. Also provided is a process for dyeing textile materials, especially denim, with indigo-irreversible color changeable dyes and for textiles and garment articles made by the dyeing process for textile materials.
US10246810B2
A washing machine is provided that may include a cabinet, a basket, and a backsplash. The cabinet may define an opening and include a backsplash bracket having a predefined footprint. The backsplash bracket may include one or more support decks, each having a planar top surface and a bottom surface. The backsplash bracket may define a first aperture extending through one support deck between a corresponding planar top surface and a corresponding bottom surface. The backsplash bracket may also define a second aperture extending through a support deck between a corresponding planar top surface and a corresponding bottom surface. The basket may be mounted within the cabinet and define a wash chamber beneath the opening to receive one or more clothing articles to be washed. The backsplash may be positioned over the predefined footprint and include a first and second engagement hook.
US10246804B2
In an aspect, a braiding machine is provided, and has a set of spool shuttles that each dispense a strand of flexible material under tension. A strand retractor releasably retracts the strands from the spool shuttles. A plurality of shuttle stations at which the spool shuttles can be positioned are arranged in a circuit. At least one shuttle carriage, when driven, repeatedly selects an immediately previously unselected spool shuttle and moves the immediately previously unselected spool shuttle from an associated shuttle station to another shuttle station along the circuit spaced from the associated shuttle station by at least one shuttle station that is intermediate the associated shuttle station and the other shuttle station. At least one spool shuttle is parkable at the at least one shuttle station. A drive arrangement is coupled to the shuttle carriage to drive the shuttle carriage.
US10246797B2
A method for manufacturing a silicon carbide single crystal includes: packing a silicon carbide source material into a crucible, the silicon carbide source material having a flowability index of not less than 70 and not more than 100; and sublimating the silicon carbide source material by heating the silicon carbide source material.
US10246786B2
An inexpensive, easily renewable bioelectronic device useful for bioreactors, biosensors, and biofuel cells includes an electrically conductive carbon electrode and a bioelectronic interface bonded to a surface of the electrically conductive carbon electrode, wherein the bioelectronic interface includes catalytically active material that is electrostatically bound directly or indirectly to the electrically conductive carbon electrode to facilitate easy removal upon a change in pH, thereby allowing easy regeneration of the bioelectronic interface.
US10246778B2
An electroless nickel plating solution and a method of using the same is described. The electroless nickel plating solution comprises (i) a source of nickel ions; (ii) a reducing agent; (iii) one or more complexing agents; (iv) one or more bath stabilizers; (v) a brightener, said brightener comprising a sulfonated compound having sulfonic acid or sulfonate groups; and (vi) optionally, one or more additional additives. The use of the sulfonated compound brightener results in a bright electroless nickel deposit on various substrates having a high gloss value.
US10246764B2
Manufacturing a cold-rolled steel plate, having a steel slab having the chemical composition containing, on the basis of percent by mass, C from 0.03 to 0.08%, Si from 0 to 1.0%, Mn from 0.2 to 0.8%, P at 0.03% or less, S at 0.01% or less, and Al at 0.05% or less so as to satisfy the following: formula (1) and at least one of Nb from 0.03 to 0.4%, V from 0.01 to 0.3%, and Ti from 0.01 to 0.3% so as to satisfy the following formula (2), with a residue being formed of Fe and unavoidable impurities. The steel slab is heated to 1200° C. or more and hot rolled to form a hot-rolled steel plate, which is wound from 550 to 700° C. to form a hot-rolled coil, and the hot-rolled coil is cold rolled or annealed and cold rolled, obtaining cross-sectional hardness from 200 to 350 HV.
US10246763B2
A medical implant and/or device, which includes a biodegradable and cytocompatible magnesium-zinc-strontium alloy is disclosed. The implant and/or device can include a biodegradable and cytocompatible magnesium-zinc-strontium (Mg—Zn—Sr) alloy having a weight percent composition of Zn and Sr as follows: 0.01≤Zn≤6 wt %, 0.01≤Sr≤3 wt %. A method for manufacturing an implant in the form of a biodegradable and cytocompatible magnesium-zinc-strontium alloy is disclosed, which includes melting the biodegradable and cytocompatible magnesium-zinc-strontium alloy in an inert environment and molding the biodegradable magnesium-zinc-strontium alloy in a semi-solid state.
US10246749B2
The invention relates to a method of diagnosing breast cancer and to the use of biomarkers for the detection and diagnosis of breast cancer.
US10246747B2
Described are methods for early diagnosis and progression monitoring of Mild Cognitive Impairment (MCI) and Alzheimer's Disease (AD) by quantifying neurite and/or synapse miRNAs in bodily fluids.
US10246744B2
Provided are compositions, methods and systems for determining the sequence of a template nucleic acid using a polymerase-based, sequencing-by-binding procedure. An examination step involves monitoring the interaction between a polymerase and template nucleic acid in the presence of one or more nucleotides. Identity of the next correct nucleotide in the sequence is determined without incorporation of any nucleotide into the structure of the primer by formation of a phosphodiester bond. An optional incorporation step can be used after the examination step to extend the primer by one or more nucleotides, thereby incrementing the template nucleotides that can be examined in a subsequent examination step. The sequencing-by-binding procedure does not require the use of labeled nucleotides or polymerases, but optionally can employ these reagents.
US10246743B2
This disclosure provides a biochip comprising a plurality of wells. The biochip includes a membrane that is disposed in or adjacent to an individual well of the plurality of wells. The membrane comprises a nanopore, and the individual well comprises an electrode that detects a signal upon ionic flow through the pore in response to a species passing through or adjacent to the nanopore. The electrode can be a non-sacrificial electrode. A lipid bilayer can be formed over the plurality of wells using a bubble.
US10246742B2
Apparatus and methods for producing ultrashort optical pulses are described. A high-power, solid-state, passively mode-locked laser can be manufactured in a compact module that can be incorporated into a portable instrument for biological or chemical analyses. The pulsed laser may produce sub-100-ps optical pulses at a repetition rate commensurate with electronic data-acquisition rates. The optical pulses may excite samples in reaction chambers of the instrument, and be used to generate a reference clock for operating signal-acquisition and signal-processing electronics of the instrument.
US10246739B2
The present invention relates to a novel method for detecting a target polynucleotide having a target sequence, comprising hybridizing the target polynucleotide with a probe to form a hybrid; exposing the hybrid to a 5′ exonuclease so that the probe in the hybrid is digested and the target polynucleotide is dissociated from the digested probe; repeating the hybridization step and the digestion step; and detecting the digested probes. The presence of the digested probes indicates the presence of the target polynucleotide.
US10246733B2
A method and assay for using carbonic anhydrase (CA), particularly CA-I or CA-II, as a biomarker of hemolysis. The method and assay detect hemolysis by determining a percentage erythrocyte hemolysis in a specimen or sample of blood based upon quantification of carbonic anhydrase present in the extracellular portion of the blood. The method and test serve to optimize therapeutic efficacy for treatments of hemolysis.
US10246718B2
The present invention relates to processes for extracting lipid from vegetative plant parts such as leaves, stems, roots and tubers, and for producing industrial products such as hydrocarbon products from the lipids. Preferred industrial products include alkyl esters which may be blended with petroleum based fuels.
US10246717B2
A series of independent human-induced non-transgenic mutations found at one or more of the SBEII genes of wheat; wheat plants having these mutations in one or more of their SBEII genes; and a method of creating and finding similar and/or additional mutations of SBEII by screening pooled and/or individual wheat plants. The seeds and flour from the wheat plants of the present invention exhibit an increase in amylose and resistant starch without having the inclusion of foreign nucleic acids in their genomes. Additionally, the wheat plants of the present invention exhibit altered SBEII activity without having the inclusion of foreign nucleic acids in their genomes.
US10246715B1
A CpG-oligodeoxynucleotide (CpG-ODN) for inducing a TLR9 activated immune response, a TLR21 activated immune response or a combination thereof in a host is provided. The CpG-ODN includes one or more copies of the sequences of GTCGTT, one or more copies of the sequences of GTT and one or more copies of the sequences of TTTT, wherein at least one copy of the sequence of GTCGTT is encoded between the sequence of GTT and the sequence of TTTT. Further, an immunogenic composition including the CpG-ODN and a method of inducing immune response by the same are also provided.
US10246712B2
A method for improving a cognitive function in a subject comprising administering to said subject an active agent reducing PKR-like endoplasmic reticulum kinase (PERK) activity is provided.
US10246702B1
Provided herein are methods and compositions for labeling target nucleic acid molecules with molecular barcodes.
US10246697B2
PmxA synthetase involved in polymyxin E synthesis, comprising four adenylation sites, characterized in that the second adenylation site has at least 90% identity with the peptide sequence SEQ ID NO 1: VTEAEKADLLGRFNDTTTEFPRGKTLIQLFEEQVERIPDAAAITLNEQE LTYRELNERVNRLARTLRSHGISKGRLVAILAERSIEMVVGMLAAHKAG AAYVPIDPEYPEERIRFLIEDSGGQVMLTQSRLRERLAGSDPVILLDDE SFYHEDGTNLNTGIEATDLACVIYTSGTTGKPKGNPVSHRNIVRVVQNT NYIDITERDHVLQLSSYSFDGATFDIFGALTNGARLVLVPYETLLEIGR LADLIQRERISVMFITTAFFNILVDVNVDCLRDVRAILFGGERVSVGHV RKALAHIGPGRLNHVYGPTESTVYTTYLPVDFVDELAVTVPIGRPISNT TVYIVDSRNKLLPIGVAGELCVGGEGLVRGYNNRPELTAEKFVDNPFVP GERMYRTGDLAKWLPDGTIEYVGRTDDQVKIRGFRIELGEIEAQLQKVE GIRKTTVFARENASGEKQLCAYYEADCELPAAELKSVLSKELPAYMIPA YLIQLERLPLTTNGKVDRRSLPAPEESLQPGGG, the underlined amino acids DGFFLGVVYK being conserved and forming a binding pocket specific for a leucine, isoleucine or valine residue.
US10246695B2
The present invention provides novels genes encoding methyl butenol (MBO) synthase, methyl butenol synthases and their use in methyl butenol production.
US10246692B2
The present invention relates to isolated polypeptides having lipase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.
US10246691B2
The present invention relates to variants of GH61 polypeptides having cellulolytic enhancing activity, wherein the variants comprise a substitution at one or more positions corresponding to positions 90, 131, 134, and 141 of the full-length polypeptide of SEQ ID NO: 2, and have cellulolytic enhancing activity. The present invention also relates to polynucleotides encoding the variants; nucleic acid constructs, vectors, and host cells comprising the polynucleotides; and methods of using the variants.
US10246683B2
The present invention concerns a novel method and assembly for extraction of regenerative cellular components from an adipose tissue, the method comprising the steps of filtering a harvested adipose tissue for recovering its liquid fraction by means of a filtering element having a first cut-off value comprised between 40 microns and 70 microns; separating regenerative cellular components present in the liquid fraction by means of cell size segregation which blocks cells bigger than a second cut-off value ranging from 8 to 20 microns; and recovering the regenerative cells-rich fraction comprising the regenerative cellular components not having being blocked during the separating step.
US10246673B2
Disclosed is the use of lignified stalks, of at least one extract of lignified stalks or of a composition containing same in a cosmetic composition, a food supplement, a nutritional product, a food or a beverage.
US10246666B2
Methods for using in situ cleaning systems which reduce water hardness and minimize chemical additives are provided. According to the methods and systems, the methods of using may comprise providing feed water to an in situ cleaning system including water treatment components, oxidizing agent generating components and/or alkalinity generating components, contacting one or more articles with a use solution generated by the in situ cleaning system, and washing the one or more articles in a washing system. In addition to the methods of using, the systems for in situ cleaning are provided.
US10246659B2
The present invention relates to an aviation gasoline composition, its production and its use in a reciprocating spark ignition aircraft engine.
US10246657B2
The present disclosure relates to novel hydrocarbon fuel blends that provide increased power and a broader operating range when utilized as fuel for homogeneous charge compression ignition engines.
US10246649B2
A process is described for reducing the total acid number of a refinery feedstock. A refinery feedstock containing naphthenic acids is contacted with an effective amount of solid catalyst that has been pretreated with an aqueous caustic base, for a period of time sufficient to neutralize at least a portion of the naphthenic acids in the feedstock. Thereafter, the aqueous phase is separated from the neutralized refinery feedstock.
US10246647B2
Systems, methods and compositions for reducing the heteroatom content of hydrocarbon feed using transition metal complexes and adsorption techniques. The transition metal complexes include titanyl, hafnyl and zirconyl complexes activated using one or more hydroperoxides or peracids. The activated adsorbents are incorporated into one or more vessels as an adsorption bed for adsorbing the heteroatoms present in hydrocarbon feeds. The systems, methods and compositions separate the heteroatoms passed through the system by contacting the adsorption compositions with the heteroatoms of the hydrocarbon feed, adsorbing the heteroatom to the adsorption material, further allowing for the retrieval of a hydrocarbon product having a reduced heteroatom content.
US10246646B2
A mobile diesel fuel refinery system comprise a particulate filter adapted to remove particulates from diesel fuel flowing through the diesel fuel conduction system, a water filter adapted to remove water from diesel fuel flowing through the diesel fuel conduction system following its passage through the particulate filter, a magnetic field of sufficient strength to further refine the diesel fuel flowing through the diesel fuel conduction system following its passage through the water filter, a catalyst injector configured to inject the catalyst from a catalyst tank into the diesel fuel flowing through the diesel fuel conduction system following its passage through the magnetic field, a dispensing conduit configured to conduct the diesel fuel from the diesel fuel refinement apparatus following injection of the catalyst.
US10246645B2
Methods for reducing flue gas particulate emissions from fluid catalytic cracking unit regenerators are provided. In one embodiment, a method for reducing flue gas particulate emissions from an FCC unit regenerator includes the steps of combining biochar with a hydrocarbon feedstock to generate a biochar-containing feedstock and contacting the biochar-containing feedstock with an FCC catalyst. In another embodiment, a method for reducing flue gas particulate emissions from a FCC unit regenerator includes the steps of fluidizing catalyst fines and biochar particles in a fluidizing gas and adhering a portion of the catalyst fines to the biochar particles while in the fluidizing gas.
US10246643B2
A process and apparatus for producing hydrocarbon oil from the thermal decomposition of waste plastics in a continuous process which comprises melting of a waste plastic feedstock into an auger assisted melt reactor to remove chlorine and organics contained in the waste plastic, and transferring the melted waste plastic into an heated screw pyrolysis reactor which includes a transitional metal heat transfer medium. The hydrocarbon gas from the pyrolysis reactor is fed into a vessel containing metal trays for a second decomposition which is connected with an alkali treatment 2-step process gas reactor to remove acidic gases, and any inorganic solids. The hydrocarbon gases are separated by three separate condensers. The hydrocarbon fraction of the first condenser is recycled back into the pyrolysis reaction for further thermal treatment, and the hydrocarbon fractions are collected in the remaining condensers.
US10246639B2
A fire retardant composition is disclosed. The composition includes polyvinyl chloride, a plasticizer, a brominated fire retardant additive, a fire retardant synergist, and a metal stabilizer. Cable separators formed of the fire retardant composition are also disclosed.
US10246637B2
A method for preparing a core-shell nanocrystal can include mixing an M-containing precursor solution, an X-containing precursor solution, and an acid or alcohol in an inert atmosphere at a first temperature to form a reaction mixture; maintaining the reaction mixture at the first temperature to grow the MX core of the nanocrystal; raising the temperature of the reaction mixture to a second temperature; and maintaining the reaction mixture at the second temperature to grow a shell of the nanocrystal.
US10246633B2
Highly stable films containing semiconductor nanoparticles (“quantum dots”) are prepared from resins containing a fast-curing inner phase having a high glass transition temperature (Tg) and certain inner phase/outer phase combinations. The resins may comprise an inner phase and outer phase (but may appear to be a single phase due to their homogeneous appearance when viewed using an optical microscope). The method provides a highly scalable and cost-effective procedure for preparing films that are resistant to light, elevated temperatures, moisture, and oxygen.
US10246618B2
The invention relates to a copolymer having polyamide PA blocks and polyether PE blocks, in which PA is of diamine.diacid X.Y type; X, the number of carbons of the diamine, is within the range from 6 to 14, and Y, the number of carbons of the diacid, is within the range from 6 to 18. The invention also relates to the use of the said copolymer in a process of direct adhesion between two TPE materials for increasing the peel strength between these materials.
US10246617B2
The invention relates to hotmelt adhesives based on polyesters, having low VOC and fogging values. In particular, the invention is directed to a polyester based on polycarboxylic acids and di- or polyols, wherein the polyester including dicarboxylic acids of the formula HOOC—(CH2)x-COOH with x>10 and diols of the formula HO—(CH2)y-OH, with the proviso that at least 50 mole percent of the dicarboxylic acids, based on the total amount of polycarboxylic acid components, and at least 50 mole percent of the diols, based on the total amount of di- or polyols, satisfy the condition x+y>18, in hotmelt adhesives.
US10246616B2
An adhesive composition includes a first acrylic polymer preparable from first components and a second acrylic polymer. The first components comprising i) a branched first alkyl (meth)acrylate having from 4 to 22 carbon atoms, and ii) at least one of acrylic acid and methacrylic acid. The second acrylic polymer is preparable from second components comprising iii) at least one second alkyl (meth)acrylate having from 4 to 22 carbon atoms, iv) a (meth)acrylamide represented by the formula wherein R1 is H or methyl, and R2 and R3 each independently represents H or an alkyl group having from 1 to 8 carbon atoms, or taken together R2 and R3 may form a divalent alkylene group having from 4 to 6 carbon atoms, and v) at least one high Tg macromer having a terminal free-radically polymerizable unsaturated group, the high Tg macromer having a Tg of at least 45° C. Based on the combined total weight of the at least one first acrylic polymer and the at least one second acrylic polymer, the at least one second acrylic polymer is present at a level of from 5 to 40 percent by weight. Methods of making the adhesive composition are also disclosed.
US10246615B2
Provided is an adhesive for use in an ultraviolet-light-emitting device using ultraviolet light having a wavelength of from 200 to 400 nm as a light source, which can attach adherends made of a polymer having a fluorine-containing alicyclic structure with excellent adhesiveness which is unlikely to be impaired by exposure to such ultraviolet light or heat.An adhesive for forming an adhesive joint in an ultraviolet-light-emitting device, which is either the following adhesive (A) or the following adhesive (B) comprising a fluoropolymer having a fluorine-containing alicyclic structure: the adhesive (A): an adhesive in which the glass transition temperature of the fluoropolymer is from 30 to 100° C., and which does not contain an ultraviolet-shielding agent; and the adhesive (B): an adhesive comprising the fluoropolymer and an ultraviolet-shielding agent.
US10246614B2
A highly homogeneous starch-based glue composition is obtained by enzymatic modification of the starch with a branching enzyme which is supplied in an enzymatically modified starch with high long-term stability. The starch has a viscosity stability index SI of less than or equal to 1.3, calculated by the quotient of viscosity after 14 days and by viscosity after 2 hours after preparation of the starch. The starch is suitable for liquid storage, which is stable in the long-term, of a ready-to-use paste with a high bonding strength.
US10246608B2
The present invention is an aqueous composition comprising at least one hydrophobic compound having at least one linkage of Formula I: —NHC(O)—X— (I) wherein X is the residue of a cyclic or acyclic sugar alcohol which is substituted with at least one —R1; —C(O)R1; —(CH2CH2O)n(CH(CH3)CH2O)mR2; —(CH2CH2O)n(CH(CH3)CH2O)mC(O)R1; or mixtures thereof; where the cyclic or acyclic sugar alcohol is selected from a saccharide, reduced sugar, aminosaccharide, aldonic acid, or aldonic acid lactone; wherein each n is independently 0 to 20; each m is independently 0 to 20; m+n is greater than 0; each R1 is independently a linear or branched alkyl group having 5 to 29 carbons optionally comprising at least 1 unsaturated bond; each R2 is independently —H, a linear or branched alkyl group having 6 to 30 carbons optionally comprising at least 1 unsaturated bond, or mixtures thereof.
US10246605B2
Provided are a resin composition for underlayer film formation with which a variation hardly occurs in the line width distribution after processing due to a small thickness of a residual film after mold pressing, a layered product, a method for forming a pattern, an imprint forming kit, and a process for producing a device.Disclosed is a resin composition for underlayer film formation which is used to form an underlayer film by being applied onto a base material, including a first resin having a radical reactive group in the side chain, a second resin containing at least one selected from a fluorine atom and a silicon atom, and a solvent. The second resin is preferably a resin containing a fluorine atom. The radical reactive group of the first resin is preferably a (meth)acryloyl group.
US10246604B2
To provide a method for producing an aqueous liquid containing a vinyl polymer, of which the production efficiency is high, without lowering the yield of the vinyl polymer. When removing a hydrophilic organic solvent from a mixed liquid comprising a vinyl polymer, the hydrophilic organic solvent and water to produce an aqueous liquid containing the vinyl polymer, a liquid phase and a gas phase are formed in a closed container, a part of the liquid of the liquid phase is formed into small droplets and brought into contact with the gas phase to vaporize the hydrophilic organic solvent, and the vaporized hydrophilic organic solvent is removed from the closed container. Specifically, for example, a closed container 10 having a liquid inlet 22, a gas outlet 30, a liquid outlet 21, a liquid inlet 22 and a liquid outlet 21 which are connected and having an external circulating system provided with means to control the temperature and the pressure of liquid, is filled with a mixed liquid 40 to form a liquid phase 50 and a gas phase 51, the mixed liquid 40 of the liquid phase 50 is circulated from the liquid outlet 21 to the external circulating system 20, and the temperature and the pressure of the mixed liquid 41 in the external circulating system 20 are controlled to conditions such that the hydrophilic organic solvent is easily vaporized in liquid droplets in the gas phase 51, followed by discharging the mixed liquid 41 in the form of the small droplets from the liquid inlet 22 to the gas phase 51 and draining the gas in the gas phase 51 from the gas outlet 30.
US10246595B2
A multifunctional material composition functioning as a halogen-free flame-retardant finish combined with in certain implementations one or both of antimicrobial and insect-repellant is nanomanufactured by the absorption/adsorption of metallic salts with one or more additional compounds by inorganic crystallites. The identity of the additional compounds is determined by the desired functionality of the substrate. The material composition can be chemically and mechanically applied to substrates (e.g. to cotton, nylon, and polyester based textile fabrics), for example, to yield durable antimicrobial, insecticidal, and environmentally friendly flame retardant materials. The addition of nano-scale metallic deposits to a phosphorous-rich and nitrogen-rich architecture complex improves the flame retardant properties of the substrates.
US10246579B2
Thermoplastic composition, comprising at least components (i) to (iii): (i) from 10 to 50% by weight of a combination of at least one first ethylene polymer (A) and at least one second ethylene polymer (B), wherein (A) is selected such as to exhibit (a) a density of from 0.87 g/cm3-0.90 g/cm3 as determined according to ASTM D792; (β) a melt flow index of from 0.3 g/10 min-5 g/10 min as determined according to ASTM D1238 (190° C./2.16 kg); (γ) a flexural modulus of from 5 to 60 MPa measured according to ASTM D790; and wherein (B) is selected such as to exhibit (a) a density of from 0.90 g/cm3-0.92 g/cm3 as determined according to ASTM D792; (β) a melt flow index of from 0.3 g/10 min-10 g/10 min as determined according to ASTM D1238 (190° C./2.16 kg); (γ) a flexural modulus which is higher than that of (A); (ii) from 35-90% by weight of inorganic particles as filler; (iii) from 0.05-20% by weight of a liquid (at 23° C.) as a plasticizer for the at least one first ethylene polymer (A) and/or the at least one second ethylene polymer (B); the % by weight of components (i) to (iii) being based on the total weight of the composition.
US10246576B2
A sulfur-crosslinkable rubber mixture includes from 40 to 100 phr of at least one natural and/or synthetic polyisoprene, and 15 phr or more of at least one hydrocarbon resin which is built up to the extent of 50 to 100 wt. % from aliphatic C5 monomers and to the extent of 0 to 50 wt. % from further monomers, where the hydrocarbon resin according to formula I) has a Q of from 0.015 [° C.·mol/g] to 0.050 [° C.·mol/g]. Formula I) is defined as Q=softening point [° C.]/centrifuge average Mc [g/mol]. In some aspects, the sulfur-crosslinkable rubber mixture includes 15 to 300 phr of the hydrocarbon resin, or even from 36 to 100 phr of the hydrocarbon resin. The further monomer(s) is or are selected from the group of unsaturated compounds, which can be polymerized cationically, which includes aromatics and/or unsaturated terpenes and/or alkenes and/or cycloalkenes.
US10246575B2
The invention relates to a polymer composition, and to a semifinished plastics product, the surface of which has been formed at least to some extent from the polymer composition. The invention further relates to a production process associated therewith for the semifinished plastics product. A feature of the polymer composition is that it comprises from 50 to 99.7% by weight of a polymer and from 0.3 to 20% by weight of one or more adhesion-promoting additives. The invention further relates to plastics-metal hybrid components and production of these.
US10246574B2
Provided is a molded article in which the formation of depressions in a vapor deposited aluminum surface of the molded article caused by long-term exposure to high-temperature conditions is suppressed such that the vapor deposited aluminum surface has excellent external appearance that has not conventionally been achieved. A light reflective part includes a polyphenylene ether resin composition containing a polyphenylene ether (A) and 9,10-dihydro-9-oxa-10-phosphaphenanthrene-10-oxide or a derivative thereof (B). The (A) component has a content of from 95 mass % to 99.95 mass % and the (B) component has a content of from 0.05 mass % to 5 mass % relative to 100 mass %, in total, of the (A) component and the (B) component.
US10246573B2
Various embodiments disclosed relate to anti-static compositions and gloves made from the same. In various embodiments, the present invention provides a doped polyaniline comprising a dopant that is a polyacrylic acid; a polymethacrylic acid; a sulfonatocalixarene; a cyclodextrin sulfate; a compound having the structure: wherein R2 is chosen from substituted or unsubstituted (C1-C10)hydrocarbyl- and substituted or unsubstituted (C1-C10)hydrocarbyl-O—, L1 is substituted or unsubstituted (C1-C10)hydrocarbylene, L2 is chosen from a bond, —O—, —O—C(O)—, and —NH—C(O)—, and n is about 1 to about 100,000; a salt thereof; or a combination thereof.
US10246567B2
There is provided a polyolefin microporous film which is excellent in taking-up stability in a production line and a processing line of the polyolefin microporous film, and further in a line for a battery taking-up step, and hardly generates step deviation when a roll thereof has received an impact.The polyolefin microporous film has a compression elastic modulus of 0.1 to 1,000 kPa, and a ratio of a tensile elastic modulus in the longitudinal direction to a tensile elastic modulus in the transverse direction of 1.5 to 7.8.
US10246560B2
Embodiments of the invention concern copolymers and nanoparticles for use as delivery agents for one or more agents for therapy for a medical condition of humans and animals. Some of embodiments of the invention provide new reagents for biomedical research in cell culture, animal models and plants, for example. The copolymers comprise PLGA and PEI and, in some embodiments, also comprise 1-(3-aminopropyl)-4-methylpiperazine (APMP), Fc binding peptide and/or antibody. In certain embodiments, APMP-PLGA-PEI, Fc binding peptide/antibody-PLGA-PEI or Fc binding peptide/antibody-AP-MP-PLGA-PEI nanoparticles comprising one or more therapeutic agents are delivered to an individual in need thereof or used for biomedical research in cell cultures, animal models and plants.
US10246559B2
The chlorohydrocarbon content of silicone resins prepared from alkoxysilanes is reduced by reacting alkoxysilane and 0.01-1 pbw chlorinated hydrocarbons with water at at least 50° C. and for at least 30 minutes, in the absence of a water immiscible solvent.
US10246558B2
A composition comprises a first siloxane compound comprising at least one cyclic siloxane moiety and a first salt, the first salt comprising a conjugate base of a volatile organic acid. A method for producing a cross-linked siloxane network comprises the steps of providing a first siloxane compound comprising at least one cyclic siloxane moiety, providing a first salt comprising a conjugate base of a volatile organic acid, combining the first siloxane compound and the first salt to produce a reaction mixture, heating the reaction mixture to a temperature sufficient for the first salt to open the ring of the cyclic siloxane moiety, and maintaining the reaction mixture at an elevated temperature so that at least a portion of the opened cyclic siloxane moieties react with each other to produce a cross-linked siloxane network.
US10246557B2
Disclosed is a curable sealant composition including: (i) a thiol-terminated prepolymer and/or monomers thereof, wherein the thiol-terminated prepolymer is a polythioether or a polysulfide; (ii) an “ene” crosslinker having a molecular weight of about 100 to about 5000; and (iii) a pH indicator molecule including a quantum dot functionalized with a pH-responsive ligand. Methods for determining a sufficient cure state of a composition by combining the thiol-terminated prepolymer and/or monomers thereof and the “ene” crosslinker with a pH indicator molecule, including a quantum dot functionalized with a pH-responsive ligand, and (ii) then subjecting a resultant mixture of (i) to curing conditions until the mixture changes its color are also disclosed.
US10246556B2
A polyimide polymer is provided. The polyimide polymer includes a repeating unit represented by formula 1. In formula 1, Ar is a tetravalent organic group derived from a tetracarboxylic dianhydride containing an aliphatic structure, and A includes and at least one divalent organic group derived from an aromatic group-containing diamine other than
US10246550B2
There is provided a resin composition which can be thermoset at a temperature of approximately 80° C., and has excellent PCT resistance and a long pot life. This resin composition is suitable as a one-component adhesive agent to be used during the manufacture of image sensor modules or electronic components. The resin composition according to the present invention is a resin composition having the following characteristics. The resin composition includes (A) a compound represented by formula (1) below, an oligomer having as its basic skeleton a structure represented by formula (2) below, (C) an epoxy resin, and (D) a curing accelerator. The mass ratio ((B)/(A)) between the compound of the (A) component and the oligomer of the (B) component is 5 to 25%. Furthermore, the total content of the compound of the (A) component and the oligomer of the (B) component is 0.5 equivalents to 2.5 equivalents in terms of the ratio of the thiol equivalent of the compound of the (A) component and the oligomer of the (B) component with respect to the epoxy equivalent of the (C) component. In addition, the chloride ion concentration in the resin composition is 230 ppm or less.
US10246543B2
The invention provides a hydrophilized polydiorganosiloxane vinylic crosslinker which comprises (1) a polydiorganosiloxane polymer chain comprising dimethylsiloxane units and hydrophilized siloxane units each having one methyl substituent and one monovalent C4-C40 organic radical substituent having two to six hydroxyl groups, wherein the molar ratio of the hydrophilized siloxane units to the dimethylsiloxane units is from about 0.035 to about 0.15, and (2) two terminal (meth)acryloyl groups. The hydrophilized polydiorganosiloxane vinylic crosslinker has a number average molecular weight of from about 3000 Daltons to about 80,000 Daltons. The present invention is also related to a silicone hydrogel contact lens, which comprises repeating units derived from a hydrophilized polydiorganosiloxane vinylic crosslinker of the invention.
US10246542B2
An atactic polypropylene comb-block polyolefin comprising two blocks including a polyolefin backbone and atactic polypropylene combs pendant to the backbone having a weight average molecular weight of at least 8000 g/mole and a crystallinity of less than 20%, where the atactic polypropylene comb-block polyolefin has comb number of at least 2. The atactic polypropylene comb-block polyolefin is made by contacting at a temperature within a range from 20 to 70° C. propylene with a first metallocene precursor to form vinyl-terminated atactic polypropylene to form vinyl-terminated atactic polypropylene, then contacting at a temperature within a range from 40 to 150° C. the vinyl-terminated atactic polypropylene with ethylene, propylene, or both and a second metallocene precursor to form the backbone.
US10246540B2
A composition of matter includes a mixture of styrene derivative monomers and methacrylate/acrylate derivative monomers, which have one or more urethane, carbamate, amide, and/or amine functional groups, and initiators, and the compositions are used to achieve composition control of the forming polymer, with the mole fraction of acrylate/methacrylate and styrene moieties in the forming polymer determined preferably by the chemistry and composition of the feeding monomers rather than the viscosity of the monomers.
US10246524B2
A method for preparing sulfobutyl ether-β-cyclodextrin. β-cyclodextrin and 1,4-sulfobutyrolactone are used as raw materials, and a proper amount of an organic solvent is introduced into an alkaline aqueous solution, so that the solubility of the 1,4-sulfobutyrolactone is increased, and the synthesis yield of the sulfobutyl ether-β-cyclodextrin is improved. Operations including ultrasonic dialysis, active carbon decoloration, freeze-drying and so on are performed on the obtained product solution, so as to obtain a powder product of the sulfobutyl ether-beta-cyclodextrin.
US10246520B2
Causes of hair loss have not been completely clarified and still remain unknown in many points. However, it appears that hair loss is partly caused by a mechanism wherein androgenic hormones in the scalp become active via the activation of DHT hormone by 5α-reductase and thus the activity of cells in hair roots is lost. In the present invention, an antibody, said antibody being obtained by inoculating a female bird with 5α-reductase or DHT as an antigen, is administered to the scalp so that the activity of DHT is suppressed and the activity of cells in hair roots is elevated. This antibody can be used in the form of a composition together with other component(s), for example, as a hair tonic together with another hair growth promoter.
US10246517B2
Provided is an antibody that recognizes and binds to carbonic anhydrase or antigen-binding fragment, a nucleic acid molecule coding for the antibody or antigen-binding fragment, a vector carrying the nucleic acid molecule, a host cell including the nucleic acid molecule or the vector, and use of the antibody or antigen-binding fragment thereof in the alleviation, prevention, treatment or diagnosis of solid cancers.
US10246515B2
Provided herein are methods of using anti-LGR5 antibodies, for example, for treating a hedgehog-related disease including basal cell carcinoma.
US10246504B2
Engineered chloride channel receptors, nucleic acids encoding these receptors, expression vectors including these nucleic acids are disclosed herein. Nanoparticles and pharmaceutical compositions including these engineered chloride channel receptors, nucleic acids, and expression vectors are disclosed. The use of these compositions and nanoparticles, such as for the treatment of pain, cystic fibrosis and asthma, is also disclosed.
US10246499B2
A composition comprising a synthetic growth factor analogue comprising a non-growth factor heparin binding region, a linker and a sequence that binds specifically to a cell surface receptor and an osteoconductive material where the synthetic growth factor analogue is attached to and can be released from the osteoconductive material and is an amplifier/co-activator of osteoinduction.
US10246490B2
Provided is a new conotoxin peptide κ-CPTx-btl02. The conotoxin peptide κ-CPTx-btl02 has derivative polypeptide that has an amino acid sequence indicated by SEQ ID NO:1, or has derivative polypeptide that has an amino acid sequence indicated by SEQ ID NO:1 and that is formed after substitution, addition or deletion of one or more amino acids are performed and has original functions. Also provided is polynucleotide for coding the peptide, comprising a constructed body of the polynucleotide, an expression carrier and transformed cells. A peptide preparation method and uses in the treatment of diseases related to a calcium ion channel.
US10246488B2
An isolated peptide is disclosed which comprises an amino acid sequence being at least 80% homologous to the sequence as set forth in SEQ ID NO: 1 (PERYQNLSPV), the isolated peptide comprising a nuclear targeting activity, the peptide being no longer than 20 amino acids.
US10246486B2
Provided are compounds of Formula I: and pharmaceutically acceptable salts and esters thereof. The compounds, compositions, and methods provided are useful for the treatment of virus infections, particularly hepatitis C infections.
US10246479B2
This disclosure provides systems and methods for sequencing nucleic acids using nucleotide analogues and translocation of tags from incorporated nucleotide analogues through a nanopore. In aspects, this disclosure is related to composition, method, and system for sequencing a nucleic acid using tag molecules and detection of translocation through a nanopore of tags released from incorporation of the molecule.
US10246471B2
Provided herein, inter alia, is the synthesis of ETP derivatives. The uses of the ETP derivatives described herein include treatment of cancer.
US10246463B2
Embodiments of small molecule inhibitors of hypoxia inducible factor 1 (HIF-1) and pharmaceutical compositions thereof are disclosed. The disclosed compounds suppress HIF-1 activity by inhibiting the interaction between the HIF-1 α subunit and transcriptional co-activator protein p300. Embodiments of methods for making and using the small molecule inhibitors are also disclosed.
US10246449B2
A 1,2,3 triazole-thiazole compound of formula (I) or pharmaceutically acceptable salt thereof, process for its preparation, its pharmaceutical composition and method for the treatment for stalling vitiligo spread or provide prophylactic benefit to individuals with vitiligo predisposition.
US10246445B2
A method is provided for producing a compound represented by formula (3), wherein n is 1, 2, 3 or 4, by mixing a compound represented by formula (2), a tri(C1-C3 alkyl)silyl(C1-C4 perfluoroalkane) and a fluoride. A method for producing the compound represented by formula (3) contains a step for producing the compound represented by formula (2) by an intramolecular dehydration condensation of a compound represented by formula (1) and by a step for mixing the compound represented by formula (2), a tri(C1-C3 alkyl)silyl(C1-C4 perfluoroalkane) and a fluoride.
US10246438B2
Disclosed herein are compounds, compositions, and methods for preventing and treating proliferative diseases associated with aberrant receptor tyrosine kinase (RTK) activity. The therapeutic indications described herein more specifically relate to the non-selective inhibition of RTKs associated with vascular and pulmonary disorders.
US10246431B2
Δ9-THC carboxylic acid is extracted from cannabis flowers using a first organic solvent, then separated using a second aqueous solvent. Δ9-THC carboxylic acid is converted to Δ9-THC carboxylic salt before being extracted by a third organic solvent and converted back to Δ9-THC carboxylic acid. Using a solvent swap, Δ9-THC carboxylic acid is decarboxylated and extracted again with an organic solvent prior to purification to give Δ9-THC.
US10246430B2
The present invention is directed to methods for preparing Beraprost and novel synthetic intermediates for Beraprost.
US10246429B2
The present invention provides a new class of compounds useful for the modulation of beta-secretase enzyme (BACE) activity. The compounds have a general Formula I: wherein variables A4, A5, A6, A7, and each of Ra, Rb, R1, R2, R3, R8 R9 and R10 of Formula I, independently, are defined herein. The invention also provides pharmaceutical compositions comprising the compounds, and uses of the compounds and compositions for treatment of disorders and/or conditions related to Aβ plaque formation and deposition, resulting from the biological activity of BACE. Such BACE mediated disorders include, for example, Alzheimer's Disease, cognitive deficits, cognitive impairments, schizophrenia and other central nervous system conditions.
US10246427B2
1,2,3-triazolyl cyclohexanol derivatives have been disclosed and their use as ligands accelerating the copper(I)-catalyzed azide-alkyne cycloaddition and the zinc(II)-catalyzed azide-nitrile cycloaddition.
US10246425B2
The present invention relates compounds of the formula: or pharmaceutically acceptable salts thereof, useful as sodium channel blockers, as well as compositions containing the same, processes for the preparation of the same, and therapeutic methods of use therefore in promoting hydration of mucosal surfaces and the treatment of diseases including cystic fibrosis, chronic obstructive pulmonary disease, asthma, bronchiectasis, acute and chronic bronchitis, emphysema, and pneumonia.
US10246422B2
The invention relates to novel heterocyclic compounds of general formula (I), as well as their pharmaceutically acceptable salts, and their enantiomers. The invention also relates to the use thereof as a medicinal product, preferably in the prevention and/or treatment of inflammatory diseases with a neurogenic component or use thereof as a cosmetic. The compounds of the present invention act as antagonists of the CGRP-R receptor.
US10246418B2
The present disclosure relates to a novel crystalline form of lenvatinib mesylate and the preparation method thereof. The novel crystalline form of mesylate of the present disclosure can be used for treating invasive and differentiated thyroid cancer. The novel crystalline form of mesylate of the present disclosure has good solubility, stability, and remarkable purification effect in process. The preparation method of this novel crystalline form is simple, low cost, and has an important value for future optimization and development of the drug.
US10246411B2
This present invention relates to (Z)-3,4,5-Trimethoxystyrylbenzenesulfonamides of general formula A. The invention also provides the synthesis of (Z)-3,4,5-trimethoxystyrylbenzenesulfonamides useful as potential antitumor agents against human cancer cell lines and a process for the preparation thereof.
US10246408B2
The present invention relates to a novel process for preparing substituted biphenylamides of the general formula (V) characterized in that anilides of the formula (II) in a solvent other than tetrahydrofuran, are reacted with an organoboron compound of the formula (III) in the presence of a catalyst system consisting of a ruthenium catalyst, an activator, an oxidizing agent and a metal triflate.
US10246405B2
Provided are a radial porous diacetylene particle, which is synthesized by ion-bonding a diacetylene-containing dicarboxylic acid or diamine monomer represented by Formula 1 with a diamine or dicarboxylic acid monomer represented by Formula 2, and a method of manufacturing the same.
US10246403B2
The present disclosure provides treprostinil derivatives that can act as prodrugs of treprostinil. The treprostinil derivatives can be used to treat any conditions responsive to treatment with treprostinil, including pulmonary hypertension, such as pulmonary arterial hypertension.
US10246398B2
Processes for producing carboxylic acid are included herein. The processes include contacting an alcohol and carbon monoxide in the presence of a liquid reaction medium under carbonylation conditions sufficient to form a carbonylation product including the carboxylic acid and recovering the carboxylic acid from the carbonylation product. The liquid reaction medium may include a carbonylation catalyst selected from rhodium catalysts, iridium catalysts and palladium catalysts; water in a water concentration ranging from 1 wt. % to 14 wt. % based on the total liquid reaction medium weight; and an additive, one or more in situ generated derivatives of the additive or combinations thereof, wherein the additive includes one or more salts of one or more compounds, each compound including at least one amino group and at least one acid group, the at least one acid group capable of forming an alkali metal salt.
US10246397B2
The present invention relates to the process for production of ketones from secondary alcohols by the use of a hybrid material, formed by the dichlorohydrotris(pyrazol-1-yl)methane iron (II) complex covalently bound to multi-walled carbon nanotubes functionalized with superficial carboxylate groups, as efficient and selective catalyst of peroxidative oxidation, microwave-assisted and without solvent addition.
US10246396B1
A vanillin having a tetramer structure is revealed, comprising a first monomer, a second monomer, a third monomer, and a fourth monomer. Each of the monomers is constituted by C8H8O3. The vanillin includes a first intermolecular hydrogen bond between the first monomer and the fourth monomer, and a second intermolecular hydrogen bond between the second monomer and the third monomer to stabilize the tetramer structure.
US10246388B2
This disclosure relates to processes which involve: contacting a mixture comprising at least one fluoroolefin and at least one RfC≡CX impurity with at least one zeolite to reduce the concentration of the at least one RfC≡CX impurity in the mixture; wherein Rf is a straight-chain perfluorinated alkyl group, and X is H, F, Cl, Br or I; and the at least one zeolite is selected from the group consisting of zeolites having pore opening of at least 4 Angstroms and no more than about 5 Angstroms, zeolites having pore opening of at least about 5 Angstroms and Sanderson electronegativity of no more than about 2.6, and mixtures thereof; provided that the at least one zeolite is not zeolite 4A. This disclosure also relates to processes for making at least one hydrotetrafluoropropene product selected from the group consisting of CF3CF═CH2, CF3CH═CHF, and mixtures thereof; and relates to processes for making at least one hydrochlorotrifluoropropene product selected from the group consisting of CF3CCl═CH2, CF3CH═CHCl, and mixtures thereof.
US10246383B2
A process is described for producing paraxylene, in which an aromatic hydrocarbon feedstock comprising benzene and/or toluene is contacted with an alkylating reagent comprising methanol and/or dimethyl ether in an alkylation reaction zone under alkylation conditions in the presence of an alkylation catalyst to produce an alkylated aromatic product comprising xylenes. The alkylation catalyst comprises a molecular sieve having a Constraint Index ≤5, and the alkylation conditions comprise a temperature less than 500° C. Paraxylene may then be recovered from the alkylated aromatic product.
US10246379B2
The invention provides compositions and methods directed to carbonation of a cement mix during mixing. The carbonation may be controlled by one or more feedback mechanisms to adjust carbon dioxide delivery based on one or more characteristics of the mix or other aspects of the mixing operation.
US10246370B2
Latent colorant material compositions, soda-lime-silica glass compositions, and related methods of manufacturing color-strikable glass containers. The latent colorant material compositions may be introduced into a plurality of base glass compositions having redox numbers in the range of −40 to +20 to produce color-strikable glass compositions and color-strikable glass containers. The latent colorant material compositions introduced into the base glass compositions include a mixture of cuprous oxide (Cu2O), stannous oxide (SnO), bismuth oxide (Bi2O3), and carbon (C). After formation, the color-strikable glass containers may be heat-treated to strike red or black therein.
US10246369B2
A high refractive index glass is provided. The glass has a refractive index greater than or equal to 1.7 and less than about 0.1 wt. % As2O3. A head mounted wearable device having a light guide optical element including high refractive index glass is also provided.
US10246364B2
A glass sheet forming method utilizes first and second upper molds and a lower mold to provide three stage forming. The glass is curved on the upper mold in the first stage but retains straight line elements transverse to the curvature. Transfer of the initially formed glass sheet from the first upper mold to the lower mold then provides the second stage of gravity forming and the glass sheet is then press formed between the second upper mold and the lower mold in the third stage which reduces optical distortion in the central viewing area of the formed glass sheet. In one embodiment the glass sheet is moved horizontally on the lower mold, and in another embodiment the glass sheet is moved horizontally on the first upper mold.
US10246345B2
A desalinating system and method is disclosed. The desalination system comprises using a turbo freeze or fast-cooling process to freeze saline water droplets and separate salt crystals from pure water crystals, wherein said system provides for simultaneous injection of saline water droplets and a chilled refrigerant into a freezing chamber at a slip velocity sufficient to reduce the size of the saline water droplets to an optimal diameter.
US10246325B2
A method for producing a MEMS device comprises forming a semiconductor layer stack, the semiconductor layer stack comprising at least a first monocrystalline semiconductor layer, a second monocrystalline semiconductor layer and a third monocrystalline semiconductor layer, the second monocrystalline semiconductor layer formed between the first and third monocrystalline semiconductor layers. A semiconductor material of the second monocrystalline semiconductor layer is different from semiconductor materials of the first and third monocrystalline semiconductor layers. After forming the semiconductor layer stack, at least a portion of each of the first and third monocrystalline semiconductor layers is concurrently etched.
US10246322B2
A distributed sensor system is disclosed that provides spatial and temporal data in an operating environment. The distributed sensor nodes can be coupled together to form a distributed sensor system. For example, a distributed sensor system comprises a collection of Sensor Nodes (SN) that are physically coupled and are able to collect data about the environment in a distributed manner. An example of a distributed sensor system comprises a first sensor node and a second sensor node. Each sensor node has a plurality of sensors or a MIMS device. Each sensor node can also include electronic circuitry or a power source. A joint region is coupled between a first flexible interconnect region and a second flexible interconnect region. The first sensor node is coupled to the first flexible interconnect region. Similarly, the second sensor node is coupled to the second flexible interconnect region.
US10246310B2
A large mobile crane including an undercarriage. The undercarriage includes a middle section between tracks, wherein a distance between the tracks can be increased or decreased by the insertion or removal of expansion parts. The two tracks are connected on opposite sides of the undercarriage to permit movement of the large mobile crane. The undercarriage also includes a drive unit, a superstructure, one or more control stations, at least two main booms, at least one derrick boom, and at least two lifting devices and counterweights. The counterweights are either arranged separately of or mounted on the undercarriage. The large mobile crane further includes a circular track, and support rollers attached to the superstructure, wherein the support rollers ride on the circular track, and wherein the circular track is an integral part of the expansion parts.
US10246308B1
An object-connecting device includes an engaging member having a perforation, a first sleeve having a first axial hole, a first abutting surface, and a first recess, a second sleeve passing through the perforation, a bolt passing through the first axial hole and the second axial hole, and a retaining ring. The second sleeve has a second axial hole, a second abutting surface, and a second recess, wherein the second axial hole communicates with the first axial hole. The second abutting surface abuts against the first abutting surface. The second recess matches with the first recess to form a receiving groove. The retaining ring is disposed in the receiving groove and is fastened on the bolt. With the aforementioned design, the bolt could be prevented from disengagement.
US10246303B2
An arrangement for guiding belt-shaped ropes of an elevator includes a plurality of belt-shaped ropes; and a rope wheel deck including a frame mounted on a structure of an elevator, a plurality of rope wheels for guiding ropes of the elevator, and plurality of bearings, wherein the rope wheels are cambered and mounted coaxially on the frame via the bearings such that they are rotatable relative to the frame as well as relative to each other, wherein only one belt-shaped rope passes around each of said rope wheels of the rope wheel deck. An elevator implements the arrangement for guiding belt-shaped ropes of an elevator.
US10246299B2
An elevator system is provided that includes a car guiderail, a first counterweight guiderail, a second counterweight guiderail, an elevator machine, a first guiderail mount and a second guiderail mount. The elevator machine includes a frame, a motor, a brake and a sheave. The first guiderail mount structurally connects the frame to the first and the second counterweight guiderails. The second guiderail mount structurally connects the frame to the car guiderail independent of the first guiderail mount.
US10246296B2
A control cable guide device for an elevator, which is to be mounted to a control cable suspended between a middle portion of a hoistway and a lower portion of a car, the control cable having a curved portion formed at a lower end position of the control cable, the control cable guide device including an arm to be suspended on the control cable at a position below the car in a pivotable manner. The arm is configured to be pushed upward by the curved portion when the car is caused to travel to a lowermost position within a normal traveling range, to thereby shift to a cable receiving position for receiving the control cable while being partially projected from the car in a horizontal direction.
US10246294B2
A regenerative elevator drive device, a method for buffering energy of a regenerative elevator drive device, and an elevator system are disclosed. The regenerative elevator drive device may include an inverter having a plurality of power components and a converter having a plurality of power components. The regenerative drive may further include a direct current (DC) link bridging the inverter and the converter, the DC link including a first capacitor bridging the inverter and the converter and a second capacitor in parallel with the first capacitor. The regenerative elevator drive device may be a multi-level regenerative drive device.
US10246292B2
The invention relates to a spinning station (1) of a spinning machine, wherein the spinning station (1) has a spinning means (2) for producing a yarn (3) from a sliver (4) fed to the spinning means (2), wherein the spinning station (1) has a winding apparatus (20) for winding the yarn (3) onto a package (16), said winding apparatus (20) being arranged downstream of the spinning means (2) in a transport direction of the yarn (3), wherein the spinning station (1) has a yarn clearer (5) arranged between the spinning means (2) and the winding apparatus (20), the yarn being monitorable for yarn defects with the aid of said yarn clearer (5), and wherein the spinning station (1) is assigned a controller (6) which is configured to interrupt the production of the yarn (3) if a defined yarn defect is detected. The invention proposes that the spinning station (1) has an information unit (7) with the aid of which it is possible to display to an operator of the spinning station (1) how much yarn (3) has to be at least unwound from the package (16) located in the winding apparatus (20) following the interruption to the yarn production in order to ensure that the yarn section having the yarn defect has been completely removed from the package (16). Furthermore, a yarn clearer and a method for operating a spinning station are proposed.
US10246282B2
A drive transmission device (6) includes a first drive train (62) and a second drive train (63). The first drive train (62) includes a first gear (621), a second gear (622), a rotary shaft (623), and one-way clutches (624). The second drive train (63) includes a third gear (631), a fourth gear (632), a rotary shaft (633), and an electromagnetic clutch (634). The third gear (631) engages the first gear (621) and the fourth gear (632) engages the second gear (622). A rotational speed of a pickup roller (12) is switched by switching on/off the electromagnetic clutch (634) to change a transmission path of driving force.
US10246278B1
An automatic tire loader/unloader for stacking/unstacking tires in a trailer is disclosed. In one embodiment, a mobile base structure provides a support framework for a drive subassembly, conveyance subassembly, an industrial robot, a distance measurement subassembly, and a control subassembly. Under the operation of the control subassembly, tires advance through a powered transportation path to an industrial robot which places the tires within the trailer in a vertical stacking pattern or a rick-stacking pattern, for example. The control subassembly coordinates the selective articulated movement of the industrial robot and the activation of the drive subassembly based upon the distance measurement subassembly detecting objects, including tires, within a detection space, dimensions of the trailer provided to the control subassembly, and dimensions of the tires provided to the control subassembly.
US10246274B2
In one embodiment, a pneumatic distribution system configured to distribute a granular product to an agricultural implement includes a first pressure sensor, a second pressure sensor, and a controller. The first pressure sensor is configured to be fluidly coupled to a storage tank configured to store the granular product and positioned upstream of the meter roller. The first pressure sensor is configured to output a first signal indicative of a first static pressure in the storage tank. The second pressure sensor is configured to be fluidly coupled to a component of the pneumatic distribution system, downstream of the meter roller. The second pressure sensor is configured to output a second signal indicative of a second static pressure downstream of the meter roller. The controller is communicatively coupled to the first pressure sensor and to the second pressure sensor. The controller is configured to determine a pressure differential, wherein the pressure differential is the difference between the first static pressure and the second static pressure. The controller may also be configured to generate a first warning when the first static pressure is below a threshold value and output the first warning to an operator interface, generate a second warning when the pressure differential is below a desired range and output the second warning to the operator interface, and generate a third warning when the pressure differential is above the desired range and output the third warning to the operator interface.
US10246254B2
A collapsible waste receptacle is disclosed with front and rear frame pieces generally defining an exterior boundary. The waste receptacle is configured to move between an expanded and a collapsed configuration. In the expanded configuration, a bottom frame piece may be attached to both the front frame piece and the rear frame piece to define at least a lower portion of the exterior boundary of the receptacle, and a top surface may contact the front frame piece and the rear frame piece. To transition to the collapsed configuration, the bottom frame piece may disconnect and rotate to generally vertical orientation within the exterior boundary of the receptacle. The top surface may rotate around a frame piece to generally vertical orientation outside the exterior boundary. The front and rear frame pieces may move towards each other to define a collapsed configuration, e.g. assisted by the inward folding of remaining side panels.
US10246252B2
A drip bag has a body formed of a water permeable sheet, an openable upper end, and hook members formed of a plate-shaped material on outer faces of two opposing body surfaces. The hook member includes: an upper stuck part adhered to the body along its opening in an elongated shape; a center part located below the upper stuck part at the body center in its width direction not to be pulled out; and a hook part not adhered to the body. Two oblique folding lines are formed on the upper stuck part with a center line therebetween, and being more spaced from the center line while extending from a lower to an upper portion of the upper stuck part, the center line bisecting the body in its width direction. A vertical folding line is formed downwardly from immediately below a lower end of the oblique folding lines.
US10246246B2
A lottery ticket dispenser array includes individual ticket bins defined by a respective housing for receipt of a supply of interconnected lottery tickets. Each bin has an electronic drive mechanism that dispenses the lottery tickets through a slot is defined in a back side of each bin housing. A separation device is adjacent the slot. A calibration slot is defined through a member internal to the housing and is located such that the lottery tickets pass alongside the calibration field in a travel path through the slot. A receiver is disposed internal to the housing opposite to the calibration slot to receive light that passes through the slot. The receiver and the drive mechanism are in communication with a control system. Based on a position of a forward edge of a leading ticket in the calibration slot and an amount of light passing through the slot and incident on the receiver, the control system determines an adjustment to a predefined length of the leading ticket to advance in a subsequent dispense cycle.
US10246240B1
My desiccator comprises a plurality of chambers in series communication with each other so a desiccating gas flows from one chamber into an adjacent chamber. A desiccating purge gas is introduced through an inlet into the desiccator's chambers at a predetermined flow rate, and a one-way bleed valve allows gas within the chambers to constantly flow from the desiccator while maintaining a positive pressure within the desiccator. A fan that constantly mixes and circulates the gas between the chambers as the desiccating purge gas is introduced into the desiccator, constantly diluting the gas within the chambers with a fresh supply of the desiccating gas. My method employs my desiccator to store items, wherein a dry, pressurized desiccating gas is introduced into the desiccator's chambers in a manner that constantly circulates the gas between the chambers as gas is slowly bled from the chambers, constantly diluting the gas within the chambers with a fresh supply of the desiccating gas. In my method the dew point of the desiccating gas is from −20 to −90 F°, the pressure of the desiccating gas is from 30 to 120 psi, and the average flow rate of the desiccating gas into the desiccator is from 0.25 to 4.0 cubic feet per minute.
US10246235B2
A packaging film made of an at least monoaxially stretched, multi-layered plastic film comprised of at least up to 50% by weight of polyolefins and having a total thickness ≤18 μm, which has an expansion of up to a maximum of 1% at a tensile force of at least 3N per 25 mm width according to DIN EN ISO 527.3
US10246226B2
A storage case includes a front cover. An upper side of the front cover is rotatably connected to a top plate via a hinge structure. An outwardly protruding locking convex part is formed on the upper side of the front cover. In a first opened state where the front cover is turned upward about the upper side of the front cover as an axis, the locking convex part comes into contact with an engagement part on the top plate. When the front cover is turned upward from the first opened state and becomes in a second opened state in which the engagement part passes over the locking convex part, the locking convex part engages with the engagement part so that the front cover is locked in the second opened state. The locking convex part is recessed from a rear side of the front cover to be in a shell-shaped form.
US10246220B2
A food container coupling system includes a food container configured to attach to a can or a beverage container lid/coupler. The food container includes a food compartment with a side wall and a bottom, which has a food compartment coupling structure. The food compartment coupling structure has an inner wall coupling structure with an inner wall jut, and is shaped complementary to the rim of a beverage can and when the food container is mounted to the beverage can, the food compartment coupling structure mates with the beverage can rim. The system may also include a beverage container lid/coupler with a coupling ring adapted to mate with the rim of a beverage container, wherein the rim defines a second plane, and a beverage container lid coupling structure extends from the second plane and can mate with the food compartment coupling structure.
US10246219B2
A foldably constructed force-resisting structure or support is provided. The foldably constructed structure may include a first member and a second member. The first member may include a support panel and a plurality of peripherally spaced first support foldably connected to the support panel. The second member may include a base panel and a plurality of peripherally spaced second support foldably connected to the base panel. Each of the plurality of first supports may include a tab. Each of the plurality of second supports may include a slot. The tab of each of the plurality of first supports may be received within the slot of each of the plurality of second supports to secure the first member to the second member.
US10246214B1
A package box includes two top plate portions at its top side, which are superimposed on each other and detachably fixed with each other through an engagement structure. The package box includes two right side plate portions at its right side, which are superimposed on each other and detachably fixed with each other through an engagement structure. The package box includes two left side plate portions at its left side, which are superimposed on each other and detachably fixed with each other through an engagement structure. The package box can be opened from the top side, the right side, or the left side after the corresponding engagement structure is opened. The package box can be formed by folding a foldable sheet material.
US10246213B2
A carton for holding one or more containers includes a plurality of panels that extend at least partially around an interior of the carton, a plurality of end flaps foldably connected to the respective plurality of panels to form at least one closed end of the carton, and at least one gusset foldably connected between the at least one side panel and the at least one closed end of the carton. The plurality of panels includes a bottom panel, a top panel, and at least one side panel. The at least one gusset is positionable between a first position and a second position wherein the interior of the carton is expanded.
US10246212B2
The invention relates to a container storage system (1) for transporting and/or for securing cargo in a container (3), and/or for partitioning the container (3), wherein the container (3) comprises side walls made of trapezoidal sheets having vertical creases (4), characterized in that the container storage system (1) comprises: At least two lateral supports (5a, b), which can be arranged vertically in at least two opposite creases (4) of at least two opposite side walls of the container (3). The supports (5a, b) each have at least one recess (13) that can be oriented to the inner chamber of the container (3) for receiving a cross bar (7). In the recess (13), at least one bearing element (11) for supporting the cross bar (7) is provided. At least one cross bar (7) is provided, which can be inserted in the at least two recesses (13) in the at least two supports (5a, b), respectively, and when installed, connects the two supports (5a, b) with one another, wherein the container storage system (1) can be assembled and dismantled without tools.
US10246200B2
An aerodynamic platform or spacecraft including a habitable 1G centripetal force rotating gravity producing interior corridor within an aerodynamic shell and an aerodynamic drone booster launch system with reentry and reuse capability.
US10246195B2
An evacuation slide may comprise an arched tube configured to extend between a first side tube and a second side tube of the evacuation slide and a strap configured to be coupled between the arched tube and a center tube of the evacuation slide. The arched tube may be configured to provide vertical support to the first side tube and to the second side tube in response to a tension in the strap. The evacuation slide may comprise a dual lane slide, the first side tube and the center tube defining a first lane and the second side tube and the center tube defining a second lane.
US10246193B1
An aircraft passenger seat that includes a seat frame including a seat back and at least one armrest, a seat bottom that includes a seat pan and a foam seat cushion positioned on the seat bottom above the seat pan, a pneumatic cushion positioned on the seat bottom between the seat pan and the foam seat cushion and adapted to maintain a predetermined level of inflation determined by air pressure within the pneumatic cushion, and a pneumatic inflation device communicating with the pneumatic cushion for permitting the air pressure within the pneumatic cushion to be varied as desired to provide additional comfort to the seat occupant. The pneumatic cushion may include at least first and second laterally-separated cushion chambers providing lateral articulation of the first and second cushion chambers relative to each other.
US10246190B2
A power drive unit (PDU) includes a light source configured to generate light as pulses with pulse intervals between the pulses. The PDU also includes a light driver configured to control the light source to generate the light at a desired intensity. The PDU also includes a light receiver configured to receive a reflection of the light. The PDU also includes a processor coupled to the light receiver and configured to determine whether the cargo is positioned on the PDU based on the reflection of the light. The PDU also includes a light controller coupled to the processor and the light driver and configured to determine an adjustment to the desired intensity of the light generated by the light source based on an intensity of the reflection of the light and whether the light source is generating a pulse or a pulse interval.
US10246185B2
An aircraft having a fixed wing is operative to perform vertical takeoff and landing while positioned in a nose-down orientation. The aircraft has a fixed wing having a leading edge and a trailing edge; a propulsion system operative to selectively provide forward propulsion and rearward propulsion; and a controller operative to control operation of the propulsion system. The propulsion system provides rearward propulsion during takeoff of the aircraft to move the aircraft in a direction of the trailing edge of the fixed wing, and provides forward propulsion during flight of the aircraft to move the aircraft in a direction of the leading edge of the fixed wing. The aircraft maintains the wing substantially vertical with the trailing edge facing upwards during takeoff, and transitions to having the wing substantially horizontal during flight. A vertical landing procedure is also provided.
US10246181B2
A method of securing a split winglet to a wing tip of an aircraft includes fastening an upper winglet to an upper winglet attachment portion of a wing attach fitting having a wing attachment portion. The method further includes fastening a lower winglet to a lower winglet attachment portion of the wing attach fitting. The method additionally includes fastening the wing attachment portion to the wing tip using tension fasteners installed from an inboard side of the wing tip to secure the split winglet to the wing.
US10246175B2
A steering control system for a watercraft includes a device locking a steering tiller, which can be activated or deactivated for maintaining the tiller in, or moving it from, a predetermined angular position. The locking device includes a hydraulic cylinder having a rod fastened to the transom of the watercraft and a cylindrical body movable along the rod and connected to a steering arm of the motor or of the rudder member. A closed circuit, opened or closed by a valve, flows oil between the two chambers of the hydraulic cylinder and the locking device can be activated or deactivated by an actuator that opens or closes the valve. An interposition element between the steering tiller and a watercraft direction changing member is pivotably articulated to the tiller, and a member transforms the pivoting movement of the tiller relative to the interposition element into commands actuating the valve.
US10246171B1
A floating vessel with a buoyant hull for cargo, with a load line presentation device affixed to the buoyant hull without interrupting water flow along the buoyant hull the load line presentation device presenting: a baseline load line indicator plimsoll mark and a plurality of increased capacity load line indicator plimsoll marks, with an increased capacity model in memory connected to a processor in communication with the load line presentation device; the increased capacity model configured for automatically integrating a plurality of variables including: wave size, wave period, wind speed, surface current, vessel length, type of vessel, quantity of disconnected superstructures, quantity of sheer, and bow height and identifying increased capacity load line plimsoll mark for a voyage of the floating vessel, the load line presentation device displays the increased capacity load plimsoll mark improving baseline capacity of the buoyant hull from 1% to 30%.
US10246170B2
A marine vessel stabilizer and control including a fin having a stem extending into the hull. An arm is connected to the stem and extends towards a connector which is connected to a rod. A housing is connected to another end of the rod and a screw passes through the housing. A motor is connected to the screw and configured to rotate to rotate the fin. A controller is connected to the motor, a speed sensor, a roll sensor and a fin position sensor such that a control signal can be calculated and the position of the fin can be determined to reduce roll of the vessel both when making headway and when at rest (zero speed). When the vessel is at rest, the fin is be configured to rotate through maximum angles greater than 15 degrees from either side of a neutral position.
US10246152B2
A displacement manipulated variable determination section 53 in a control device 40 for a mobile robot 1 determines, for each of contacting portions 13, 23 of a plurality of movable links 3, 4, a displacement manipulated variable for making a desired position and/or posture of the contacting portion 13 or 23 displaced, by integrating, under a predetermined condition, a deviation between an observed value of an actual contact reaction force acting from an external object and a desired value thereof. The control device 40 controls an actuator 41 that drives a corresponding joint, in accordance with the displacement manipulated variable determined and a reference operational goal for the mobile robot 1.
US10246151B1
An example implementation for determining mechanically-timed footsteps may involve a robot having a first foot in contact with a ground surface and a second foot not in contact with the ground surface. The robot may determine a position of its center of mass and center of mass velocity, and based on these, determine a capture point for the robot. The robot may also determine a threshold position for the capture point, where the threshold position is based on a target trajectory for the capture point after the second foot contacts the ground surface. The robot may determine that the capture point has reached this threshold position and based on this determination, cause the second foot to contact the ground surface.
US10246145B1
A tire carrier assembly includes a tire carrier, a carrier support assembly which is lockable and unlockable and configured to support the tire carrier in a stowed position when locked and to lower the tire carrier toward a deployed position when unlocked, and a hoist coupled to the carrier support assembly. The hoist is configured to lock the carrier support assembly and to be selectively actuatable to unlock the carrier support assembly.
US10246142B2
A structural member for a vehicle projects from a vehicle body. The structural member includes a first airflow surface and a second airflow surface along each of which airflow flows, and an imaging window. The first airflow surface and the second airflow extend between a front edge and a rear edge of the structural member in a front-rear direction of the vehicle body and face away from each other. The first airflow surface has a length longer than a length of the second airflow surface in the front-rear direction. The imaging window is provided in the first airflow surface, and an image of an area outside the vehicle body is captured through the imaging window.
US10246141B2
Disclosed are active variable-width aerodynamic spoiler assemblies, methods for making or for operating such active spoiler assemblies, and vehicles equipped with such active spoiler assemblies. A disclosed active spoiler assembly for modifying the aerodynamic performance of a motor vehicle includes a main body rigidly mounted to the vehicle body, extending transversely across the vehicle. The main body has an elongated construction with opposing longitudinal ends. First and second fins are each movably attached to a respective one of the opposing longitudinal ends of the main body. Also, first and second fin actuators are each attached to the vehicle body and attached to a respective one of the movable fins. The first fin actuator is selectively actuatable to independently move the first fin between respective retracted and extended positions, whereas the second fin actuator is selectively actuatable to independently move the second fin between respective retracted and extended positions.
US10246136B2
An underbody cladding is provided for a two-track motor vehicle with wheel-controlling links as part of a rear axle for cladding the underbody. The underbody cladding at least partially extends in a substantially horizontal plane and extends in the direction of the outside of the vehicle close to an inner side of a rear wheel. The underbody cladding is divided into three sections, a front section, a central section and a rear section. The central section extends at least over a region below the wheel-controlling links and is connected at least over part of the width thereof to the front section and/or the rear section. The central section is designed in such a manner that the section can at least partially follow and/or yield to a vertical movement of the wheel-controlling links. The front and the rear section of the underbody cladding can in each case be arranged in a positionally fixed manner on the motor vehicle and cannot follow and/or yield to a vertical movement of the wheel-controlling links.
US10246132B2
A device for rear impact mitigation of a vehicle is disclosed herein. In some embodiments, the device includes a Y-shaped frame having a first leg, a second leg, and a reaction member, the reaction member having a first end and a second end, the first leg and the second leg extending from the first end of the reaction member at a first area and defining an angle therebetween, the reaction member having a straight portion proximate the first end and a curved portion defining a second area proximate the second end, wherein the frame is configured to deform at one or more of the first area and the second area upon application of a force from a rear impact event to the vehicle.
US10246119B2
A steering column device includes a cylindrical inner jacket; a cylindrical outer jacket in which the inner jacket is slidably inserted; and a steering shaft rotatably supported in the inner jacket and the outer jacket. The outer jacket is divided into a molded first half member and a molded second half member at a plane including an axis of the outer jacket. According to this steering column device, in molding the outer jacket, it is not necessary to set a draft for a core along the axial direction on the inner circumferential surface of the outer jacket.
US10246117B1
A hand-driven, wheeled carrier deceleration device, applied to an axle of a hand-driven, wheeled carrier, is introduced and has a wheel, driven gear, reluctance motor and resistive component. The wheel, pivotally disposed at the axle, has a drive gear which rotates together with the wheel. The driven gear, disposed beside the axle, meshing with and driven by the drive gear, has a connection portion. The reluctance motor, connected to the connection portion and driven by the driven gear, has permanent magnets and metal elements. The metal elements and permanent magnets are arranged annularly. The metal elements rotate relative to the permanent magnets. The resistive component electrically connects to the permanent magnets. Therefore, a driving force exerted on the hand-driven, wheeled carrier is partially offset by reluctance to effectively slow down the hand-driven, wheeled carrier.
US10246110B2
The present invention relates to a heavy freight train marshalling device and marshalling method, and an electronically controlled pneumatic brake system; the latitude and longitude data of the carriage control unit is acquired by a Beidou positioning module; the first-vehicle state data of the carriage control unit is acquired by detecting a first-vehicle identification terminal; and, the carriage control units only need to transmit the acquired location data and the first-vehicle state data to the HEU via communication modules. Accordingly, the number of communication messages between the carriage control units and the HEU is decreased, the complicated process of connecting the carriage control units to or disconnecting the carriage control units from a switchable load is omitted, the marshalling time is shortened, and the complexity of marshalling is reduced.
US10246108B2
A linkage articulatedly connects a railcar end portion of a coupling rod to a railcar body. A longitudinal axis of the coupling rod, in the neutral position, coincides with the longitudinal direction of the rail-borne vehicle. The linkage includes a base plate coupled via a bearing to the railcar body. The base plate has a through opening for the coupling rod extending therethrough. A pull/push assembly includes a first supporting element arranged between the base plate and the railcar body and a second supporting element on the side of the base plate facing away from the railcar body. First and second spring units are disposed between the base plate and corresponding ones of the supporting elements. The base plate is mounted in the bearing block to pivot in a horizontal plane transversely with respect to the longitudinal direction.
US10246101B2
A computer in a vehicle is programmed to operate a vehicle along a predefined course according to predetermined criteria, record an optimal path through the predefined course based on operation of the vehicle according to the predetermined criteria, monitor operation of at least one vehicle control while the vehicle is operated by a human driver along the predefined course, and actuate the at least one vehicle control based on a predetermined deviance from the optimal path.
US10246091B2
An system and method of operating an adaptive cruise control system for a vehicle. In one example, the system includes a rearward facing sensor, a speed control, and a controller. The controller receives at least one parameter indicative of a road condition or a traffic condition. The controller then activates a coasting mode based on the at least one parameter. The controller receives a signal from the rearward facing sensor indicative of a presence of a target vehicle positioned behind the host vehicle and restricts the coasting mode when the signal from the rearward facing sensor detects the target vehicle is positioned behind the host vehicle. The controller performs coasting via the speed control when the signal from the rearward facing sensor does not detect the target vehicle positioned behind the host vehicle and when the coasting mode is active.
US10246090B2
Vehicles can be equipped with a computing device to determine two or more paths of available paths for the vehicle that each include a predicted impact with an object. The computing device can determine a time to impact, vehicle speed and direction and object speed and direction, and an object type. The computing device can also determine a best path of the two or more vehicle paths by determining damage severity based on time to impact, vehicle speed and direction and object speed and direction and control one or more of steering, propulsive torque and braking torque to pilot the vehicle on the best path based on the damage severity.
US10246068B2
A pressure modulator for an ABS system includes a housing that which has a hydraulic inlet and a hydraulic outlet that are interconnected via a hydraulic line; a volume accumulator that increases a volume of the hydraulic line during an activated anti-lock function, a linear drive for opening the volume accumulator and an electronic circuit that controls the linear drive and is disposed in the housing.
US10246062B2
A semi-trailer landing gear, in particular for trailers of utility vehicles, wherein the semi-trailer landing gear extends along a longitudinal axis and comprises an outer supporting tube and/or a transmission box, wherein the outer supporting tube and/or the transmission box comprise an outer wall, and wherein the outer wall comprises a fastening side, wherein at least one fastening portion is formed in the region of the fastening side, and wherein the fastening portion is designed to fasten and/or to arrange the semi-trailer landing gear on a further element, in particular a trailer, characterized in that a transmission is arranged in the transmission box, which transmission is coupled to a spindle drive, in that the fastening portion comprises at least one fastening element, and/or in that the fastening portion comprises at least one arrangement portion for arranging and/or fastening the at least one fastening element, and in that a ratio of a distance between the fastening elements and/or the arrangement portions of two fastening portions transversely to the longitudinal axis of the semi-trailer landing gear to a width of the transmission box or the outer supporting tube in this region is less than 1.
US10246058B2
A driver for retaining a windscreen washer liquid pipe includes an orifice arranged to receive a rotation shaft, an outer contour when the driver is observed along the rotation axis, and a housing arranged to receive a curved portion of the windscreen washer liquid pipe around the orifice. The rotation shaft is rotated about a rotation axis. The housing is arranged so that, when the driver is Observed along the rotation axis and when the windscreen washer liquid pipe is installed on the driver, the curved portion of the windscreen washer liquid pipe is set back from the outer contour of the driver.
US10246055B2
A method for authorizing a driver to activate at least one system of a vehicle, includes a preliminary phase that includes an initialization step, an enrollment step scanning enrollment biometric data of the driver, an access step for the driver to enter the vehicle, and a storage step registering enrollment biometric data in memory. The method also includes a subsequent phase that includes an authentication step scanning authentication biometric data of the driver and comparing said authentication biometric data with the enrollment biometric data in the memory, then an activation step wherein, if the authentication biometric data match with the enrollment biometric data, in authorizing the driver to activate the at least one system of the vehicle, or a refusal step wherein, if the authentication biometric data does not match with the enrollment biometric data, in forbidding the driver to activate the at least one system of the vehicle.
US10246050B2
A retractor and a seat belt device that can achieve miniaturization of a device by thinning a part of an automatic lock mechanism. The automatic lock mechanism includes a switching plate that is rotatably connected to the spool via a speed reduction gear, and a lever member that is operated by the switching plate. The switching plate includes a disc-shaped guide part, a first projected part disposed on a first surface of the guide part, and a second projected part disposed on a second surface of the guide part. The lever member includes a first lever in contact with the first projected part, a second lever in contact with the second projected part, and a gap disposed between the first lever and the second lever, through which the guide part can pass.
US10246047B2
To provide a seat belt retractor and a seat belt apparatus in which contact between a locking base and a base frame can be suppressed. A seat belt retractor includes a spool 2 that retracts a webbing restraining an occupant, a base frame 3 that accommodates the spool 2 while allowing the spool 2 to rotate, and a lock mechanism 4 regulating rotation of the spool 2. The lock mechanism 4 includes a locking base 41 disposed at an end portion of the spool 2, an opening 31 that is formed in the base frame 3 and allows the locking base 41 to be inserted therethrough, engagement teeth 32 formed at an inner edge of the opening 31, and a pawl 42 that is disposed radially outwardly movable relative to the locking base 41 and engageable with the engagement teeth 32. The lock mechanism 4 further includes a protect cover 43 that is attached to the locking base 41 and includes a side wall portion 43b disposed along a side surface portion of the locking base 41.
US10246046B2
A vehicle seatbelt assembly includes a first member, a second member, a buckle mechanism, and a clutch mechanism. The first member is configured to attach to one of a vehicle floor structure and a seat structure. The second member is supported on the first member. The second member is configured for limited sliding movement relative to the first member. The buckle mechanism is attached to the second member for movement therewith. The buckle mechanism has a latch device configured to releaseably retain a seatbelt latch tongue member. The clutch mechanism is disposed between the first member and the second member and is operable to switch between a dis-engaged state and an engaged state. In the dis-engaged state, the clutch mechanism allows movement of the second member relative to the first member. In the engaged state, the clutch mechanism prevents movement of the second member relative to the first member.
US10246040B2
The invention relates to an airbag module comprising a housing (14) for an airbag (16) and a cover (12), the housing including a fabric part (14) which at least partly encloses the airbag (16), characterized in that means (20; 30; 60) for fastening the housing (14) which are formed integrally with the cover (12) are provided and in that the fabric part (14) is arranged directly on the fastening means (20; 30; 60).
US10246039B2
An airbag device 100 restrains an occupant of a front passenger seat 104 from a front side of the vehicle. The airbag device 100 includes a housing 120 having an opening 132, and a cushion 108 including a main bag 112 inflated and deployed from the housing 120 toward a front side of the front passenger seat 104 and a support bag 114 inflated and deployed from the housing 120 toward a rear side of a center console 116. The main bag 112 and the support bag 114 each have a bag shape and are reduced in size and stored in the housing 120 in a stored form 130 such that the support bag 114 is placed on the main bag 112 on the side of the opening 132.
US10246038B2
The present invention addresses the problem of attaining an object recognition device that can change control of a vehicle in accordance with the reliability of detection of a target object. The object recognition device according to the present invention recognizes a target object around a vehicle and includes: a distance-information-based target object determination unit 106 that determines whether or not an object 303 is a target object by using distance information from the vehicle 301 to the object 303; an image-information-based target object determination unit 107 that determines whether or not the object 303 is a target object by using image information obtained by capturing an image of the object 303 from the vehicle 301; and a target object detection reliability calculation unit 108 that calculates the reliability of detection of a target object by using the distance information and the image information.
US10246037B1
Among other things, a documentation of a crash involving a vehicle is generated automatically. Telematics data is received that has been produced by one or more sensors associated with a telematics device at the vehicle. Based on the telematics data, a vehicle crash period is determined that begins at a start time and ends at an end time of the vehicle crash. Based on the telematics data, one or more metrics are determined associated with the vehicle during the vehicle crash period. Based on one or more metrics, a human-readable documentation of the vehicle crash is generated automatically.
US10246036B2
A bumper assembly includes a crush can, a bumper extending along a longitudinal axis and supported by the crush can, and a secondary bumper assembly. The secondary bumper assembly is supportable by the bumper, and includes a secondary bumper that extends along the longitudinal axis, and a hand-actuated release supported by the secondary bumper having an arm attachable to the bumper. The arm is moveable between an engaged position for engagement with the bumper and a disengaged position for disengagement with the bumper.
US10246033B2
A protector includes: a first unit into which an electrical wire is to be inserted; and a second unit into which a portion of the electrical wire is to be inserted, the portion being other than a portion that is not to be inserted into the first unit. The first unit includes a coupling-target portion, and the second unit includes a coupling portion that is coupled to the coupling-target portion so as to be rotatable relative to the coupling-target portion.
US10246028B1
An apparatus is provided capable of holding one or more drink cups and a purse, pocketbook or like parcel. The apparatus includes a body having a first cup well and a second cup well. A hook is carried on the body. The hook is displaceable between a home position, wherein the hook is aesthetically integrated into the body, and a deployed position wherein the hook is available for holding the purse, parcel or pocketbook.
US10246017B2
This invention relates to a view angle adjustment mechanism. A view element tilting section is tiltably supported by the tilting support section. Upon a motor being driven, a nut member rotates together with a gear member, the nut member rises/falls along a male thread member, whereby the view element tilting section is tilted. At a barrel of the nut member, a protrusion is formed. The protrusion is fitted in a groove of the gear member and causes the nut member to rotate together with the gear member. At the tilting support section, a protrusion abutment portion is formed. When the nut member moves in a direction in which the nut member comes off from the male thread member, the protrusion abutment portion abuts on the protrusion and thereby prevents movement of the nut member.
US10246014B2
A method for determining distraction of a driver of a vehicle, including sampling sensor measurements at an onboard system of the vehicle; generating an output indicative of a distracted state; determining that the driver of the vehicle is characterized by the distracted state, based on the output; generating, at a second distraction detection module of a remote computing system, a second output indicative that the driver is characterized by the distracted state, based on the sensor measurements; computing a distraction score, at a scoring module of the remote computing system, in response to generating the second output and based on the sensor measurements and the distracted state.
US10246013B2
Provided is an automobile proximity warning system that notifies a detection object such as a pedestrian of automobile proximity while ensuring quiet for surrounding environment. A plurality of parametric speakers (13, 14, 15) are arranged so as to emit sound outside a vehicle from different positions of a vehicle body of an own vehicle. When a detection object existing around the own vehicle is detected by a sensor device, a distance detecting unit (5c) detects the direction and distance to the detection object, with the own vehicle being as a reference, from detection information from the sensor device. A warning control unit (5d) selects any of the speakers (13, 14, 15) for emitting sound in the direction and controls warning sound to be emitted while adjusting breadth of the directivity of the speaker in accordance with the distance.
US10246009B2
A user-activated, non-contact power closure member system and method of operating a closure member of a vehicle are provided. The system includes at least one sensor for sensing an object or motion. An indicator is located on the vehicle to inform the user of the appropriate location to make an activation gesture, which initiates opening of the closure member. The indicator is located adjacent the at least one sensor. The indicator also informs the user if the system is activated, in motion, and/or waiting for the activation gesture. An electronic control unit is connected to the at least one sensor and the indicator. When the object or motion is detected by the at least one sensor, the control unit notifies the user with the indicator, determines if the object or motion is the correct activation gesture, and initiates movement of the closure member.
US10246005B2
A vehicle lighting system is provided primarily for use with emergency response vehicles. The vehicle lighting system includes at least one luminescent planar sheet affixed to a vehicle's mounting surface. The luminescent planar sheet includes a non-luminescent printed circuit board in the shape of a letter or number which has a top surface of a color which contrasts with the mounting surface's color. The luminescent planar sheet includes a plurality of light emitting LEDs which are surface mounted upon the printed circuit board so as to be arranged in the shape of the desired letter or number with the LEDs covering no more than 20% of the printed circuit board's top surface. Preferably, the LEDs cover no more than 7% the printed circuit board's top surface.
US10245986B2
A vehicle seat including: a seat back including a top plate main part configured to support a body of a seated person from the rear side and a top plate side part configured to protrude more forward than the top plate main part to support the body of the seated person from the lateral side; a side adjuster configured to move the top plate side part between a protruding position in which the top plate side part protrudes more forward than the top plate main part and a retracted position in which the top plate side part is retracted from the protruding position; and a controller configured to, in a case where a side collision of a vehicle is detected, drive and control the side adjuster so that the top plate side part is in the protruding position.
US10245980B2
A child safety seat assembly includes a support base, and a child carrier operable to detachably assemble with the support base. The support base has a shell body that defines a receiving area and includes an upright surface raising upward from a bottom surface, the shell body being assembled with a latch located adjacent to the upright surface. The child carrier includes a seat shell having a foot portion protruding downward, the foot portion having an interior in which are assembled a release arm and a fixed rod. The foot portion is placed on the bottom surface in the receiving area and the latch engages with the rod when the child carrier is locked with the support base, and the release arm is operable to push the latch to disengage from the rod for removal of the child carrier from the support base.
US10245972B2
A through the road (TTR) hybridization strategy is proposed to facilitate introduction of hybrid electric vehicle technology in a significant portion of current and expected trucking fleets. In some cases, the technologies can be retrofitted onto an existing vehicle (e.g., a trailer, a tractor-trailer configuration, etc.). In some cases, the technologies can be built into new vehicles. In some cases, one vehicle may be built or retrofitted to operate in tandem with another and provide the hybridization benefits contemplated herein. By supplementing motive forces delivered through a primary drivetrain and fuel-fed engine with supplemental torque delivered at one or more electrically-powered drive axles, improvements in overall fuel efficiency and performance may be delivered, typically without significant redesign of existing components and systems that have been proven in the trucking industry.
US10245967B2
A system and method for managing vehicle charging stations such that when at least two of a plurality of electric vehicle charging stations (also known as electric vehicle service equipment, or EVSE) occupied with vehicles awaiting a charge, the present system manages the charging of individual vehicles in cases where the aggregated demand for charging exceeds the capacity of the circuits supplying the plurality of EVSE. By cycling so that only a few of the vehicles are charging at a time, the demand on the circuits is kept below a predetermined limit. In cases where a load shedding event is in progress, the limit can be further reduced. In cases where the cost of electricity is varying dynamically, the system considers a driver's explicit charging requirements (if any) and preferences for opportunistic charging when the price of electricity is not too high.
US10245965B2
The invention relates to a transmission coil (10) configured for inductive energy transfer, comprising a carrier (17), a coil arrangement (11) having a plurality of turns (12), and a capacitance. It is thereby provided that the capacitance is formed of a plurality of capacitors (22), wherein each capacitor (22) is assigned to an individual turn (12) or to a group of at least two turns (12) of the coil arrangement (11), and together with the coil arrangement, the capacitors (22) are arranged on the carrier (17). The invention further relates to a stationary charging station and to a vehicle, each comprising such a transmission coil (10), and to a system for the inductive charging of vehicles. No drawing text to be translated.
US10245964B2
An electric vehicle having an electric motor is provided. The electric vehicle having a receptacle slot integrated in the electric vehicle. The receptacle slot provides an electrical connection for providing power to the electric motor. A battery having an elongated form factor, where a first end of the elongated form factor includes a handle and a second end of the elongated form factor includes a connection for interfacing with the electrical connection of the receptacle slot of the vehicle, when the battery is slid into the receptacle slot for electrical engagement. The battery is configured to store and supply charge to power the electric motor of the electric vehicle and the battery is replaceable by sliding the battery out of the receptacle slot and sliding in another battery into the receptacle slot to further supply charge to power the electric motor of the electric vehicle with said another battery. The battery and said another battery each have a respective handle that is accessible for enabling hand-removal and hand-insertion of said battery and said another battery out of and into the receptacle slot. A computer on-board the electric vehicle is interfaced with the electrical connection of the receptacle slot to obtain a level of charge of the battery present in the receptacle slot. A battery level indicator of the electric vehicle provides information regarding the level of charge of the battery in the receptacle slot. A system for storing and charging batteries usable by the electric vehicle is further provided. In some examples, the batteries are additionally or alternatively recharged using green sources, such as wind or solar.
US10245961B2
An inverter-charger combination includes plurality of first and second switching elements, a capacitor, and a dual active bridge, connected in parallel to one another. The first and the second switching elements are connected in series to form switching subassemblies that are disposed in parallel and are connected to an AC source. Each of the first and the second switching elements has a first and a second contactor, and, when the first contactor is open and the second contactor is closed, an electric current flows from a rechargeable energy storage system (RESS) in direct current form to a load in AC form through the switching subassemblies to provide power to the load, and when the first contactor is closed and the second contractor is open, an electric current flows from the AC source in AC form to the RESS in DC form through the switching subassemblies to charge the RESS.
US10245951B2
In a pump system for a hybrid electric transmission, the pump is alternately driven by the input shaft and the output shaft, whichever is rotating faster. The input shaft and output shaft are co-axial. Sprockets and a chain transmit power from axis of the input and output shafts to the axis of the pump. The driven sprocket is selectively coupled to the input shaft by a first one-way-clutch and selectively coupled to the output shaft by a second one-way-clutch. Two alternative one-way-clutch and bearing arrangement are disclosed.
US10245918B2
A heating system for a vehicle includes a low-temperature circuit and a high-temperature circuit which can be operated independently of each other and in which a low-temperature cooler or a high-temperature cooler is arranged. The two cooling circuits are coupled to each other via two coupling points for the exchange of coolant, and have a common conduit section, which extends between the two coupling points and on which a heat exchanger is arranged for heating the passenger compartment. A respective heat exchanger is arranged in the two cooling circuits, namely a low-temperature heat exchanger or a high-temperature heat exchanger for receiving waste heat from a respective vehicle component. The cooling circuits can be switched between a cooling operation and a heating operation.
US10245916B2
The compact low-profile air conditioner unit is configured to be installed through the roof of a truck cabin, and run off of electrical power. The vehicle air conditioner includes a compressor, a blower fan, and a housing assembly. The housing assembly includes a mounting base having a top side and an opposing bottom side. The mounting base is configured to be mounted to a roof of a vehicle. The compressor and the blower fan are each mounted to the mounting base. When installed to the roof of the vehicle via the mounting base, the compressor and the blower fan each extend at least partially through the roof of the vehicle.
US10245908B2
A system for tire inflation including a drive mechanism defining a rotational axis, including an eccentric mass that offsets a center of mass of the drive mechanism from the rotational axis along a radial vector; a pump arranged radially distal the rotational axis of the drive mechanism, including a chamber defining a chamber lumen, and a reciprocating element arranged at least partially within the chamber lumen and translatable along a pump axis; a drive coupler coupled between the drive mechanism at a first position and the reciprocating element at a second position fixed to the reciprocating element; a torque regulation mechanism; and a controller, communicatively coupled to the torque regulation mechanism; wherein the system is operable between at least a first mode and a second mode by the torque regulation mechanism in cooperation with the controller.
US10245906B2
A system and method of estimating a load bearing on a vehicle tire includes an inflation pressure measuring sensor for measuring an inflation pressure level within a tire cavity; a contact patch length sensor measuring the rolling contact patch length of the tire; a tire rolling speed sensor measuring a rolling speed of the tire; and a tire wear state estimation calculator estimating a tire wear state of a tread of the tire. An artificial neural network estimates a tire load from the contact patch length, the inflation pressure level, and the tire rolling speed by utilizing as a compensation factor input the estimated tire wear state.
US10245902B2
An objective of the present invention is to provide a pneumatic tire whereby primarily rolling resistance is minimized and noise is minimized. This pneumatic tire tread rubber (5) comprises: a cap part (50) which is formed of non-conductive rubber and configures a grounding surface; a base part (51) which is disposed on the inner side of the cap part (50) in a tire radial direction (RD); and conductive parts (52) which are disposed in both of a pair of lateral end parts which are at ends of the cap (50) in a tire width direction, traverse the inner part of the cap (50) while avoiding a location which covers the grounding surface, and form shapes which connect the grounding surface with the bottom surface (50b) of the cap part (50) in the tire meridian cross-section. The conductive parts (52) are provided with extended sites (52b) which branch off outward to the tire width direction (WD) from conductive paths (52a) which connect the grounding surface with the bottom surface (50b) of the cap part (50). The conductive parts (52) are formed of a conductive rubber which has different rubber hardness from the non-conductive rubber which forms the cap part (50).
US10245893B2
A pneumatic tire includes a pair of circumferential grooves, a plurality of lateral grooves, and longitudinal grooves communicating between the lateral grooves on the outsides, in a tire width direction, of the circumferential grooves. Each lateral groove includes a lateral groove first portion, a lateral groove second portion disposed further outward, in the tire width direction, than the lateral groove first portion, and a lateral groove step portion connecting the lateral groove first portion and lateral groove second portion.
US10245891B2
A tread for a heavy vehicle tire of total thickness PMU this tread when new having a tread surface is provided and disclosed herein. The tread includes at least one cut opening in the initial condition onto the tread surface, this cut being such that it includes an external part having the form of a groove in the main direction, this groove having a mean depth Pe less than 80% of the thickness PMU, an internal part forming the bottom of the cut, this internal part having the shape of a channel of mean width Le and mean height He, this channel being intended to form a new continuous groove when the part wear of the tread reaches at most 80% of the thickness PMU.
US10245890B2
A tire includes a tire carcass and a tread extending circumferentially about the tire carcass. The tread includes a plurality of tread elements disposed in a tread pattern. The plurality of tread elements have one of two different pitch lengths and are disposed in a noise-reducing pitch sequence.
US10245885B2
A pallet moving system includes a pallet dolly puller, and a pallet dolly with a guiding structure thereon permitting and facilitating the blind engagement and disengagement of the dolly puller to the pallet. The dolly puller includes caster wheels, a handle, and at least one projecting portion configured to mateably couple with recessed portions on the underside of the pallet dolly in order that the pallet dolly may be moved and readily re-positioned even in confined spaces.
US10245876B2
The invention relates to a security element (1) with authentication information (2) for checking the correct combination of two support parts (3, 4, 5), characterized in that the security element (1) comprises at least one first partial element (6) comprising first partial information (7) and a second partial element (8) comprising second partial information (9). The first partial element (6) can be associated with a first support part (3) and the second partial element (8) can be associated with a second support part (4), both partial elements (6, 8) can be moved from a starting position into a checking position in which both partial elements (6, 8) overlap. The first partial information (7) and the second partial information (9) represent the authentication information (2) when in the checking position.
US10245873B2
A binding mechanism cartridge is detachably held by a binding device body instead of a staple cartridge which is detachable into the binding device body. The binding mechanism cartridge includes a body portion, an upward-and-downward moving portion and a base portion. The body portion is detachably held by the binding device body. The upward-and-downward moving portion is on the body portion to move close to or away from one surface of a bundle of sheets by moving upward and downward by interlocking with a drive mechanism of the binding device body. The base portion is on the body portion to face the upward-and-downward moving portion and supports the other surface of the bundle of sheets. The upward-and-downward moving portion includes a binding mechanism which is partially in pressure contact with the one surface according to a movement of the upward-and-downward moving portion to binds the bundle of sheets.
US10245868B2
Provided is an image transfer material, comprising a support, optionally at least one barrier layer, a melt transfer layer, and an image receiving layer. Also provided is a process for preparing the image transfer material. Further provided is a heat transfer process using the disclosed material. In the heat transfer process, after imaging, the image receiving layer and melt transfer layer are peeled away from the optionally barrier-coated support material and placed, preferably image side up, on top of a receptor element. A non-stick sheet is then optionally placed over the imaged peeled material and heat is applied to the top of the optional non stick sheet. The melt transfer layer then melts and adheres the image to the receptor element. A composition comprising: at least one self-crosslinking polymer, and at least one dye retention aid.
US10245855B2
Provided is a photo printer including: a base adapted to accommodate paper therein; a pickup roller protruding from the bottom of the base to feed the paper accommodated in the base forwardly; a platen roller disposed in front of the base to discharge the paper fed by the pickup roller forwardly; a head located above the platen roller to apply given heat to the paper; a motor; a transgear engaged with the motor; a first power transfer part for connecting the transgear and the rotary shaft of the platen roller with each other to rotate the platen roller; and a second power transfer part for connecting the transgear and the rotary shaft of the pickup roller with each other to rotate the pickup roller. The transgear, the first power transfer part and the second power transfer part are disposed on the same side surface of the base as each other.
US10245852B2
A photo-curable ink jet ink set includes an undercoating photo-curable ink jet ink containing a (meth)acrylic acid ester having a vinyl ether group expressed by general formula (I), and an overcoating photo-curable ink jet ink. The undercoating photo-curable ink jet ink has a higher surface tension than the overcoating photo-curable ink jet ink.
US10245847B2
Provided is a reaction solution containing any one or more kinds of organic solvents from esters, alkylene glycol ethers, cyclic esters, and alkoxyalkyl amides; and an aggregating agent which aggregates components of an ink composition, in which the reaction solution is used for a recording method performed by using the ink composition.
US10245843B2
A thermal head of the disclosure includes a substrate; a heat generating section disposed on the substrate; an electrode disposed on the substrate, the electrode having a connecting portion connected to the heat generating section; and a protective layer which covers the heat generating section and the connecting portion of the electrode, a part of the protective layer which is disposed on the connecting portion having a closed first void therein.
US10245830B2
According to an example, a printing system may include a drop ejecting element and a fluid circulating element corresponding to the drop ejecting element. The printing system may also include a logic device that is to receive a data stream addressed to the drop ejecting element, determine whether the data stream indicates that the drop ejecting element is to be energized, and in response to a determination that the data stream does not indicate that the drop ejecting element is to be energized, energize the fluid circulating element.
US10245819B2
A system for manufacturing a display unit according to an exemplary embodiment of the present invention includes: a carrying unit configured to carry an optical film including a polarizing film and a release film, wherein the polarizing film includes an adhesive layer through which, a release film adheres to and is peeled from the polarizing film; a cutting unit configured to cut the optical film up to a predetermined depth to form a polarizing film sheet piece on the optical film, without cutting the release film; a panel supply unit configured to continuously supply a panel to an attachment position, at which the polarizing film sheet piece is attached to one surface of the panel; an attachment unit configured to peel the polarizing film sheet piece from the release film, and attach the peeled polarizing film sheet piece to the one surface of the panel supplied by the panel supply unit; and a winding unit configured to wind the release film peeled by the attachment unit, wherein the attachment unit includes: an adhering means, which has an adhering property at an external side thereof, and peels the polarizing film sheet piece from the release film by the adhering property, and moves to the attachment position and makes the polarizing film sheet piece face the one surface of the panel in parallel; and an attaching means, which presses the adhering means to attaches the polarizing film sheet piece to the one surface of the panel.
US10245811B2
The surface protective film of the present invention is characterized in that the film comprises a polyolefin-based substrate layer and a pressure-sensitive adhesive layer, the pressure-sensitive adhesive layer contains at least a styrene-based elastomer, an acrylic-based pressure-sensitive adhesive and a tackifier, and in the pressure-sensitive adhesive layer, the styrene-based elastomer is blended in an amount of not less than 50% by mass but not more than 90% by mass based on the total amount of the pressure-sensitive adhesive layer, the acrylic-based pressure-sensitive adhesive is blended in an amount of not less than 1% by mass but not more than 40% by mass based on the total amount of the pressure-sensitive adhesive layer, and the tackifier is blended in an amount of not less than 1% by mass but not more than 49% by mass based on the total amount of the pressure-sensitive adhesive layer.
US10245809B2
A heterogeneous composite has a first layer which includes a fiber layer, a metal layer, a plastic layer or a combination thereof, a second layer which includes a fiber layer with a plastic layer, or a fiber layer with a non-woven cloth layer, and a base layer which is a thermoplastic layer. The first layer and the second layer are respectively mounted on the base layer by a glue layer, and the compressive strength value between the first layer and the second layer is less than 20%. The base layer enhances strength of the whole composite, and the heterogeneous composite provides a beautiful and competitive product.
US10245804B2
An alternate resin-coated paper material for use in making honeycomb. The alternate resin-coated paper material is made from a paper that contains from 30 to 50 weight percent aramid fibers and from 50 to 70 weight percent of non-aramid fibers. A fire retarded phenolic resin is incorporated into the paper to make it self-extinguishing in less than 10 seconds with a self-extinguishing burn length of less than 12 inches when exposed to a 12-second vertical flame in accordance with the vertical burn test requirements set forth in 14 C.F.R. Part 25.583. The fire retarded phenolic resin includes a phenol formaldehyde resin and a phosphorous-containing fire retardant.
US10245801B2
A briquetting machine for loose metal scraps comprises a pre-extrusion part, a re-extrusion part and a final pressing part. On the upper portion of a pre-extrusion cavity (14) of the pre-extrusion part, a pre-extrusion releasing area (15) is formed near to one side of a re-extrusion cavity (24). At the front end of a re-extrusion plunger (23) of the re-extrusion part, a lateral gap (28) is formed near to one side of the pre-extrusion cavity. The cross section of the lateral gap is a right-angled trapezoid and the lateral gap is provided with a lateral slope (29). A briquetting method for loose metal scrapes is disclosed. By way of pre-extrusion and step-by-step feeding and triggering resetting loading, not only is a certain pre-pressing effect guaranteed while the loose metal scraps are processed in each feeding and pre-pressing step, but also the stress can be transferred and released timely under the over-pressure condition, which avoids the formation of dense metal block under the over-pressure condition. Therefore a continuous, automatic and safe pressing operation is assured.
US10245799B2
Baler devices, systems, and methods are shown and described. In one embodiment, the device includes an access door that is generally repositionable about a maintenance opening in a compression chamber. A chamber maintenance assembly may include a repositionable chamber access door, a pair of opposing hydraulic actuators, and a pair of extension arms connecting the access door and the hydraulic actuators. The result is devices, systems, and methods to provide improved access to the compression chamber to attend to jamming maintenance.
US10245785B2
The present disclosure provides method and systems for printing a three-dimensional (3D) object. A method for 3D printing may comprise providing a mixture comprising (i) a polymeric precursor, (ii) a photoinitiator configured to initiate formation of a polymeric material from the polymeric precursor, and (iii) a photoinhibitor configured to inhibit the formation of the polymeric precursor. The method may comprise exposing the mixture to (i) a first light to cause the photoinitiator to initiate formation of the polymeric material, thereby to print the 3D object, and (ii) a second light to cause the photoinhibitor to inhibit the formation of the polymeric material. During printing of the 3D object, a ratio of (i) an energy of the second light sufficient to initiate formation of the polymeric material relative to (ii) an energy of the first light sufficient to initiate formation of the polymeric material may be greater than 1.
US10245772B2
Apparatus and method for detecting a position of an actuator piston driving a valve pin in an injection molding system. The apparatus includes an actuator housing having a body portion, surrounding an axial bore, of a substantially non-magnetic and/or magnetically permeable material, a piston, movable within the axial bore for driving a valve pin, the piston including a magnetic member generating a magnetic field such that axial movement of the piston in the bore modifies the magnetic field according to the position of the piston relative to a detection position, and a magnetic field detector attached to an exterior surface of the body portion at the detection position for detecting the magnetic field associated with the position of the piston and generating an output signal determined by the piston position.
US10245768B2
A method for forming a component exhibiting a sealed interior, including providing first and second mold halves, foaming first and second half shells of material within cavities defined within each of the mold halves, and upon mating the mold halves together in a first closed mold configuration. The mold halves are reopened, with at least one of the shells being subsequently reoriented such that the first and second half shells are arrayed in opposing fashion with perimeter extending edges of each half shell arranged in contact with one another. Additional steps include reclosing the mold halves and subsequently forming a second perimeter extending material in contact with the contacting perimeter extending edges in order to bond the half shells together, upon which the mold halves are reopened and a completed component removed.
US10245767B2
A bracket assembly suitable for use with an electronic device is described. The bracket assembly may include a bracket body having a channel. The bracket assembly may further include a membrane embedded in the bracket body and designed to allow air, but not liquid (such as water), to pass through the membrane. The membrane may be at least partially surrounded by a membrane support molded to the membrane. The membrane and the membrane support may be disposed in a molding tool to receive a material used to mold the bracket body over the membrane and the membrane support. During the molding operation, the membrane support may act as a buffer to shield the membrane from temperature and pressure increases associated with the molding operation of the bracket body. The bracket assembly may improve the ability of the electronic device to prevent liquid ingress.
US10245766B2
The invention relates to a method for manufacturing a composite casing for an axial turbomachine low-pressure compressor. The casing comprises a circular wall and a fixing flange which with the wall forms a sharp-edged corner. The method comprises the steps of: supplying a mold with a corner configured to form the edge corner of the casing; placing a filled thermoplastic resin profile section along the corner; placing a fibrous reinforcement in the mold to hug the profile section; closing the injection mold; polymerizing a resin injected into the mold and demolding the casing. The invention also relates to a composite casing with an annular wall and a flange at one end of the wall forming a sharp-edged corner on the inside of the casing. The casing is reinforced by a fibrous perform and the edge corner is reinforced with short fibers with a mean length of less than 5.00 mm.
US10245761B2
A mold (30) for a wind turbine component (10) is described. The component comprises a plurality of elements having different respective heat capacities. The mold comprises an inner mold layer (38) defining a mold surface (40) for supporting the plurality of elements, heating means (44) disposed beneath the mold surface, and a heat distribution layer (46) adjacent to the heating means. The mold has one or more first regions (34) configured to support elements of the component having relatively high heat capacity, one or more second regions (36) configured to support elements of the component having relatively low heat capacity, and one or more transition regions (35) defined between the first and second regions. The heat distribution layer in one or more transition regions of the mold is configured to enhance heat transfer within the distribution layer to one or more first regions of the mold.
US10245758B2
An integral rescue accessory for forcible entry and core drill may include hydraulic wall saws, a rotating platform, and a coring claw. Two hydraulic wall saws are symmetry installed on rotating platform. The wall saws cut linearly with the rotation of rotating platform to open a rectangular tunnel on a reinforced concrete wall or floor. After the cutting process, coring process is finished by the wall saws and claw inclinedly mounted to ensure the security of rescue. The whole accessory is installed on a large engineering machine through a hydraulic joint. The present disclosure can transfer general large mechanical equipment into dedicated large mechanical equipment quickly.
US10245755B2
A reduced weight, reduced density gypsum panel that includes high expansion vermiculite with fire resistance capabilities that are at least comparable to (if not better than) commercial fire rated gypsum panels with a much greater gypsum content, weight and density.
US10245754B2
A safety system with a number of component devices that may be used alone or in combination to substantially reduce the risk of injury to the operator of the power cutting tool. The devices are designed for use with table saws, miter saws, jointers, routers, shapers and similar equipment. The devices secure a work piece against unanticipated movement and kickback while simultaneously protecting the operator's hands. The devices further enhance the capabilities of power equipment to make precise cuts safer, faster and easier. One such device includes a guide member for engaging a work piece and an adjustable alignment member for orienting the position of the guide member relative to a cutting blade.
US10245743B2
A waste stripping unit in a packaging production machine (1), positioned downstream of a cutting unit (3). The stripping unit includes a frame and two rotary tools cooperating with one another (17, 18). A first tool has waste stripping needles protruding radially outward from the outer surface. The two tools (17, 18) are mounted in a removable cassette (22). A frame (23) is provided with bearings supporting the two tools (17, 18), and which can be introduced into, attached to and extracted from the frame (16).
US10245738B2
Embodiments of the present invention provide a pair of sampling scissors and a method for using the sampling scissors. With the sampling scissors and the method, a sample of a rubbing cloth for testing may be obtained in a single operation, and damage to the rubbing cloth during the sampling process is thus decreased, so that the rubbing cloth will meet the requirement of uniformity of rubbing alignment. The sampling scissors comprise a tray, a blade, a first hand grip and a second hand grip; wherein the tray is connected with the first hand grip and the blade is connected with the second hand grip, and the first hand grip is pivotably connected with the second hand grip through a central shaft; and wherein the blade comprises a first cutting edge disposed at edges of the blade, and a projection of the first cutting edge onto a bottom surface of the tray is a hollow and closed pattern and the first cutting edge is perpendicular to the bottom surface of the tray for shearing off a sample which is to be received in the tray. The sampling scissors according to embodiments of the present invention are used to sample the rubbing cloth.
US10245737B2
Devices and methods for use in removing the foliage from stems of leafy vegetables and sprigs of herbs are shown and described. The device has a body that is sized and shaped to fit comfortably into a one hand. The body can be generally flat and can have at least one edge following a convex curve. A trimming blade projects outwardly from at least a portion of the convexly curved edge of the body. A selection of apertures of different sizes extends through the body. The user can select an aperture large enough to allow the stem to pass through, but too small for the foliage to pass through. During use, a user can use the trimming blade to trim off unwanted parts from a sprig of herb or a piece of leafy vegetable, pass the sprig through a selected aperture sized to remove the foliage therefrom, and cut the foliage to the desired size by rocking the trimming blade along its length over the foliage.
US10245734B2
A manipulation system includes: a manipulator that operates a microscopic object; a first input unit that generates a first movement command signal for moving the manipulator to a manipulator position corresponding to an input operation position; and a second input unit that generates a second movement command signal for moving the manipulator to a manipulator stored position stored in a storage. When the input operation position of the first input unit is a predetermined input operation position, the manipulator is enabled to be moved by an operation of the first input unit, or the manipulator is enabled to be moved by an operation of the second input unit.
US10245728B2
A monitoring system includes at least one three-dimensional (3D) time-of-flight (TOF) camera configured to monitor a safety-critical area. An evaluation unit is configured to activate a safety function upon an entrance of at least one of an object and a person into the monitored area and to suppress the activation of the safety function where at least one clearance element is recognized as being present on the at least one of the object and the person.
US10245718B2
A protection apparatus for a machine tool, at least for protecting a workpiece surface against overheating, includes at least one sensor unit and at least one evaluation unit. The sensor unit has at least one sensor element. The sensor element detects at least one characteristic variable of a fluid flow provided for transporting material removed from a workpiece. The evaluation enables identification of at least one temperature of a workpiece surface of the workpiece to be machined via the machine tool based at least in part upon the at least one characteristic variable detected via the sensor unit.
US10245716B2
An accessory for coupling to an attachment mechanism of an oscillating power tool includes a working end, an opposite rear end, and a fitment portion adjacent the rear end portion. The fitment portion includes a central opening having a central portion and a rearward portion open to the rear end, and configured to receive a post of a tool clamping mechanism. The fitment portion further includes a first plurality of openings in communication with and extending radially outward from the central portion, a second plurality of openings not in communication with and positioned radially outward from the central portion. The central portion, the first plurality of openings, and the second plurality of openings are configured to couple the fitment portion to a plurality of different configurations of attachment mechanisms for oscillating power tools.
US10245712B2
A ratchet wrench having a quick release structure includes a drive bar, a rotary head, and a locking switch. The drive bar includes a fork arm, a fork opening formed at the fork arm, an axial hole communicating with the fork opening, and a radial hole communicating with the axial hole. The rotary head is pivotally connected to two ends of the fork arm. The rotary head includes a round housing, a plurality of positioning recesses disposed on the round housing, and a pivot axis passing through the rotary head. The pivot axis is perpendicular to the radial hole. The locking switch includes a turning element disposed in the radial hole and a latch element disposed in the axial hole. The turning element rotatably drives the latch element to move axially, and the latch element is engaged with or released from any positioning recess.
US10245709B2
Provided is a nipping tool with which it is possible to nip an object, such as a cable, appropriately in accordance with the thickness or size of the object. This nipping tool is a nipping tool in which two members, each including a grip part and an operation part, are rotatably connected, and the operation parts open and close in association with the opening/closing of the grip parts. The grip part has a plurality of holding positions. The shape of the grip part is such that the degree of opening of the operation parts differs when the two members are closed together using the various holding positions.
US10245692B2
A chain-type tool magazine for detachably holding a plurality of pots on a chain and circulating the pots, provided with: U-shaped link members having openings for detachably holding pots, the link members having first rollers protruding on the side of the openings and second rollers on the side opposite from the opening; link members which do not have a roller; a chain assembly in which the plurality of link members are alternately joined by pins in an endless manner; guides for guiding the first rollers and the second rollers so that the chain assembly bends in the forward and reverse directions and circulates in a meandering manner; and driving means for circularly driving the chain assembly.
US10245691B2
The controller for a machine tool according to the present invention makes it possible to discharge both a coolant and an oil mist from a through hole provided in the tool equipped to a main axis of a machine tool, allows a processing program to instruct the discharge of either the coolant or the oil mist, and carries out such a control that a state where the above-described tool is detached from the main axis is maintained during a predetermined period of time at the time of replacing the tool, and at the same time, the oil mist is discharged from the above-described oil mist unit so as to remove the coolant from the above-described piping during the predetermined period of time.
US10245689B2
The invention concerns a rod tensioning device having a first actuator, at least a second actuator and a tubular support sleeve dedicated to radially surround a threaded rod. Each of the actuators provides a cylinder, and a piston sliding in the cylinder and forming with the cylinder an annular chamber dedicated to be supplied with pressurized fluid. According to the invention, the at least second actuator is temporary axially arranged between the first actuator and the tubular support sleeve for a temporary blockwise assembly, the pistons of two axially adjacent actuators being indexed in rotation together.
US10245688B2
A method of coupling or decoupling a tool of a rotary-drive sub-assembly and a tool retainer of the rotary-drive sub-assembly includes rotationally anchoring the tool to a first tool-change member, rotatably coupled to a base, by engaging a tool-change-engagement portion of the tool with a first tool-engagement portion of the first tool-change member. The method also includes causing relative rotation between the tool and the tool retainer.
US10245686B2
The present invention relates to a conditioning method of gas turbine engine components (e.g. compressor blades and vanes) for aerodynamic noise reduction. The gas turbine engine components are plasma treated in a high vacuum environment to generally reach a surface roughness (Ra) below 150 nanometers and in some cases below 25 nanometers. Then during the same process the components are coated using either a metallic or ceramic, hard, thin coating ranging from 100 to 3000 nanometers in thickness depending on desired surface smoothness and non-fouling properties. The same treatment combined with a surface relaxation process, which is part of a smoothing process, allows applying even up to 100 micrometers of hard coating without changes to high cycle fatigue properties and overall performance. Improved surface smoothness of the components and enhanced non-adhesiveness of the contaminants advance the quality of the flow through the gas path and compressor aerodynamic noise reduction.
US10245679B2
A laser welding head includes a shield gas injection nozzle and welding wire supply nozzle, wherein the shield gas injection nozzle and the welding wire supply nozzle include a main body section and a surface layer section that covers the main body section, and at least part of the surface layer section is formed by at least one of ultra-hard alloy, cermet and ceramics.
US10245664B2
Bevel gear cutting machines having multiple numerically-controllable axes, a workpiece spindle, which accommodates a bevel gear coaxially in relation to a workpiece spindle axis, and a deburring device having a deburring spindle for accommodating at least one first deburring tool. The bevel gear cutting machines may chamfer tooth edges of the bevel gear in two passes, where, in a first pass, first chamfers are provided on the tooth edges by using the first deburring tool, and, in a second pass, second chamfers are provided in the region of the first chamfers by using the first deburring tool or by using a second deburring tool in a continuous procedure, in which the bevel gear and the first or second deburring tool rotate in a coupled manner while engaged with one another.
US10245659B2
A cutting insert has: first sub cutting edges at positions corresponding to first corner portions of a polygonal top surface; second sub cutting edges at positions corresponding to second corner portions; and main cutting edges on side portions. In a side view, each of the main cutting edges has a first cutting edge adjacent to the first sub cutting edge, a second cutting edge adjacent to the second sub cutting edge, and a third cutting edge between the first cutting edge and the second cutting edge. Each of the main cutting edges inclines such that the height thereof decreases from a portion adjacent to the first sub cutting edge to a portion adjacent to the second sub cutting edge. An inclination angle of the third cutting edge is greater than inclination angles of the first cutting edge and the second cutting edge.
US10245658B2
The present invention relates to a cutting device and a chamfering machine comprising the same, and according to one aspect of the present invention, a cutting device for use in a chamfering process of a film laminate is provided, in which the cutting device comprises a rotating wheel having a rotation center; and a cutting bite comprising a main body mounted on the rotating wheel and a cutting tip provided on the main body and provided to perform chamfering of the film laminate by rotating the rotating wheel, wherein the cutting bite is mounted on the rotating wheel such that the central axis of the cutting tip is inclined at a first angle with respect to the tangential direction of a rotation locus of the cutting bite formed by rotating the rotating wheel.
US10245648B2
An aluminum alloy hub lathe fixture, which includes a main plate, a mounting seat, a hydraulic power clamping head, a pull rod, a sliding seat, a connecting pin, a fan-shaped clamping jaw, a sealing cover, a deflection block, a deflection shaft, a centrifugal force balance block, a centrifugal mechanism base, a spring and screws, wherein the main plate and the mounting seat are connected together through screws, so that a housing of the entire fixture is formed; the hydraulic power clamping head is fixed on the mounting seat through screws; one end of the pull rod is mounted on the hydraulic power clamping head through screws, and the other end of the pull rod is connected with the sliding seat through the connecting pin; the fan-shaped clamping jaw is fixed on the sliding seat through screws.
US10245647B2
The invention relates to a tool holding fixture (1) for rotationally driven tools (2), said tool holding fixture comprising a rotationally symmetrical holding body (3) which has a front clamping portion (4) having a holding opening (5) for a tool shaft (6) of the tool (2), and a rear holding portion (7) to be held in a work spindle of a machine tool. To achieve a reduced mass, a lower mass moment of inertia and at the same time high stiffness, a sleeve (11) consisting of a fiber-reinforced plastic is arranged at least in the front clamping portion (4).
US10245644B2
A cutting insert including a surface involved in cutting, for which a cutting tool material of a hard sintered body is used. A radius of a nose R portion is 0.4 mm or greater and 2.4 mm or less, an apex angle α of the nose R portion is 50° or greater and 95° or less, a rake angle β at a position of a bisecting plane of the apex angle of the nose R portion is 1° or greater and 10° or less, a chamfer provided in a cutting edge portion is a negative land with unequal width, and at least on one side of the negative land with respect to a boundary which is an apex of a nose R portion cutting edge, a width of the negative land gradually decreases from the apex of the nose R portion cutting edge to a position at which the nose R portion cutting edge is connected to a linear cutting edge. Let W1 be the width of the negative land at the apex of the nose R portion cutting edge, and W2 be the width of the negative land at both ends of the nose R portion cutting edge, then the W1 is 0.04 mm or greater and 0.2 mm or less, and a ratio of the W1 to the W2 is 1.5 or greater.
US10245643B2
A sintered body includes a first hard particle, a second hard particle, and a binder. The first hard particle is an M sialon particle having a coating layer. The M sialon particle is represented by MxSi(6−x−z)AlzOzN(8−z) (in the formula, M is a metal containing at least one selected from the group consisting of calcium, strontium, barium, scandium, yttrium, lanthanoid, manganese, iron, cobalt, nickel, copper, and group IV, group V, and group VI elements of the periodic table, and relationships of 0.01≤x≤2, 0.01≤z≤4.2, and 1.79≤(6−x−z)≤5.98 are satisfied). The second hard particle is a cubic boron nitride particle.
US10245633B2
A method for machining a plate-like workpiece with a processing machine includes forming a receptacle in the plate-like workpiece for an insert part and machining the receptacle based on one or both of an orientation at which the insert part is to be inserted into the receptacle and a side of the plate-like workpiece from which the insert part is to be inserted into the receptacle. The method further includes running a machining program to carry out the forming and the machining of the receptacle. A computer program product is provided to configure a programming system by which the machining program is generated.
US10245611B2
A slurry distributor for use in a continuous manufacturing process includes an inlet opening and a shaped duct adapted to receive a flow of slurry provided at the inlet opening. The shaped duct has a parabolic guide surface adapted to redirect the flow of slurry. An outlet opening in fluid communication with the shaped duct is adapted to discharge the flow of slurry from the slurry distributor.
US10245595B2
A high voltage power supply for an electrostatic precipitator comprises a high voltage transformer, a high voltage bridge rectifier and a semiconductor switch controller configured to control an output power level of the high voltage power supply. A control unit (50) is configured to determine a firing angle of firing pulses for the semiconductor switch controller. During normal operation, a peak voltage value is measured and stored in each half period. When a breakdown is detected, a residual voltage (Ur) over the electrostatic precipitator is measured. A firing angle (α1) of a firing pulse to be provided to said semiconductor switch controller in the first half period after the breakdown is determined from the latest stored measured peak voltage value (Ubef) and the measured residual voltage (Ur) based on a predetermined relationship between the firing angle (α1) and said measured voltages.
US10245584B2
A droplet ejecting apparatus includes a plurality of nozzle groups each including a plurality of nozzles, a plurality of pressure chambers each configured to supply a solution to a corresponding nozzle of a nozzle group in the plurality of nozzle groups, a plurality of actuators each configured to cause a pressure change in a corresponding pressure chamber in the plurality of pressure chambers to control an ejection of a droplet of the solution from the corresponding nozzle, and a solution holding container having a solution inlet for receiving solution and a solution outlet, the solution holding container being configured to supply the solution to the plurality of nozzle groups via the plurality of pressure chambers.
US10245576B1
The magnetic polymer nanocomposite for removal of divalent heavy metal ions from water is magnetic nanocomposite having a core of magnetite (Fe3O4) in a shell of branched polyhydroxystyrene (BHPS), designated as Fe3O4@BHPS. The nanocomposite is synthesized by co-precipitation in alkali solution. Testing showed the nanocomposite reached 93% and 80% Pb(II) and Cd(II) adsorption, respectively, in 30 minutes, attaining equilibrium in 120 minutes. The maximum adsorption capacities of Pb(II) and Cd(II) at 298K were 186.2 and 125 mg/g, respectively. After adsorption, the nanocomposite with the heavy metal(s) adsorbed thereto was easily removed from aqueous solution by application of a magnetic field.
US10245575B2
A vessel system for high-pressure reactions is disclosed. The system includes a plugged polymer cylinder reaction vessel with a pressure vent opening extending radially through the wall of the reaction vessel and a supporting frame into which the vessel is received. Complementing keying structure elements on the vessel and on the frame limit the orientation of the reaction vessel in the supporting frame and the radially extending vent opening to a defined single position.
US10245569B2
A bone filler mixing and delivery device includes a mixing section adapted to mix components to form bone filler. A syringe barrel is coupled to the mixing section and has an opening through which the bone filler can be dispensed. A controllable portal can be manipulated to open a flow path between the mixing section and the syringe barrel. A plunger assembly is adapted to extend telescopically in an axial direction through the syringe barrel to dispense the bone filler through the opening.
US10245562B2
A pervaporation membrane formed from a series of vinyl addition block polymers derived from functionalized norbornene monomers are disclosed and claimed. Also disclosed are the fabrication of membranes which exhibit unique separation properties, and their use in the separation of organic volatiles from biomass and/or organic waste, including butanol, phenol, and the like.
US10245558B2
A nanocomposite membrane includes a macroporous polymer membrane having a plurality of pores. A plurality of metal nanoparticles are synthesized and immobilized within those plurality of pores. The nanoparticles are reduced and capped with a green reducing and capping agent such as green tea extract.
US10245554B2
The invention relates to a gas purifier that removes moisture and oxygen from inert gases and reducing gases, for example, at sub-atmospheric pressures. The purifier can remove part per million levels of moisture in a gas stream to less than 100 parts per trillion by volume, and has a low pressure drop and a sharp breakthrough curve.
US10245552B2
A carbon dioxide separation method including the steps of: feeding a mixed gas that contains at least carbon dioxide and water vapor to a carbon dioxide separation membrane that contains a hydrophilic resin and a carbon dioxide carrier; separating, from the mixed gas, a permeation gas that contains the carbon dioxide by use of the carbon dioxide separation membrane; adjusting temperature of gas which contacts the carbon dioxide separation membrane so that a temperature difference between the mixed gas and the permeation gas is not lower than 0° C. and not higher than 20° C.; and adjusting pressure of the permeation gas, the pressure of the permeation gas and water vapor partial pressure in the mixed gas satisfying the following formula (1): 2.5 kPaA<(pressure of permeation gas)<(water vapor partial pressure in mixed gas) . . . (1).
US10245550B2
A separation method including: an absorption process absorbing a desired component in a starting material gas into an absorption liquid by bringing the starting material gas and the absorption liquid into contact with each other inside an absorption unit; a regeneration process releasing the desired component from the absorption liquid and regenerating the absorption liquid by heating the absorption liquid, which absorbed the desired component in the absorption process, in a regeneration unit; a post-regeneration separation process separating the mixed fluid, which is the gas of the desired component released in the regeneration process and the regenerated absorption liquid, into the desired component gas and the absorption liquid; and a compression process compressing the starting material gas prior to the absorption process and the regeneration process.
US10245549B2
A method and a device for separating off an electrolyte from a first synthesis gas and a second synthesis gas, each containing an electrolyte. The two synthesis gases are each subjected in a scrubbing column to a water scrubbing, in which a substantially electrolyte-free synthesis gas and also a scrubbing water loaded with an electrolyte that has been separated off are obtained. At least a part of the scrubbing water that was loaded with an electrolyte that has been separated off in the scrubbing of the first synthesis gas is used as scrubbing medium in the scrubbing of the second synthesis gas.
US10245541B2
A filter (1) for filtering air, in particular an air filtering element (30), is provided for releasably fitting into a housing (10) which has a housing upper part (11) and in particular a central tube (20) fastened to the housing upper part (11), and also the housing for the filtering element (30) is provided. The filtering element has a seal (33, 34) for holding the filtering element (1) on the housing upper part (11) and the central tube (20) and for sealing the space (111) between the filtering element (30) and housing upper part (11) when the filtering element (30) is releasably fitted in the housing (10). The seal (33, 34) is connectable in a form-fitting manner to a sealing receptacle (111) of the housing upper part (11) and/or of the central tube (20).
US10245540B2
An inertial particle separator for an aircraft engine inlet, including inlet, intermediate and bypass ducts. The intermediate duct extends generally transversally from the inlet duct to the engine inlet, and communicates with the inlet duct adjacent its downstream end. The bypass duct extends downstream from the inlet duct and intermediate duct, and defines an outlet communicating with the environment of the engine. A wall of the intermediate duct intersects a wall of the inlet duct on an engine side of the wall of the inlet duct. The engine side of the wall of the inlet duct defines an engine-side inlet air flow line of the inertial particle separator. A wall of the bypass duct intersects the wall of the intermediate duct closer to a central axis of the engine than an extension of the engine-side inlet air flow line into the bypass duct.
US10245538B2
Filtering panel 100 for passively adsorbing micro particles such as atmospheric pollutants or the like, the panel having a first outer layer 10, a second outer layer 30 and an intermediate filtering layer 20 arranged between the first and second outer layers 10 and 30, the intermediate filtering layer 20 having a support structure impregnated with porous active carbons, where at least one of the outer layers 10 and 30 is optionally suitable for painting and/or coloring and/or printing, the panel 100 being therefore suitable for use for displaying information and/or directions, for example of an advertising or commercial nature, as well as an urban, extra-urban and domestic design element.
US10245536B2
A filter head may include a receiving component and a threaded metal nozzle insert at least partly injected into the receiving component. The receiving component and/or the filter head may be composed of plastic. The threaded metal nozzle insert may be structured as a cold extruded part. A plurality of radially extending ribs may be disposed in a cavity of the receiving component and/or the filter head. The ribs may be composed of plastic and/or integrally formed with the filter head. The ribs may extend along a radial direction from the threaded nozzle insert to a wall of the cavity. The ribs may additionally lead radially outward into an axial sealing surface of the filter head.
US10245533B2
Disclosed is a pore adjusting filtering apparatus including: a cylinder having a plurality of holes and in which a screw is rotatably installed; an endless track coupled to an outer peripheral surface of the cylinder by a cylinder, an endless track pin, and a support to be rotatable together with the cylinder; a fiber yarn bundle support rod inserted into the endless track to be connected to the endless track; a fiber yarn bundle, one end of which is fitted with and supported by the fiber yarn bundle support rod; a fiber yarn bundle support net for supporting the fiber yarn bundle while being attached to an outer peripheral surface of the fiber yarn bundle; a cleaning separator fixedly installed at an upper outer side of the cylinder; and an ejector installed on an upper outer side of the cylinder.
US10245528B2
A device (10) for a skimming operation for petrochemical or chemical fluid storage or process tanks working by gravitation, comprising buoyancy means (20), means (30) for collecting surface fluid to be skimmed including an opening (31) emerging just above the interface between the fluid with density d1 and the fluid with density d2, as well as connection means (32), and discharge means (40) for the collected surface fluid. The discharge means (40) includes at least two flexible pipes (41, 42) connected symmetrically to the connection means (32) and extending vertically in the fluid with density d2 toward the bottom of the tank.
US10245524B2
An apparatus to quickly position a start assist device for backstroke swimmers and remove said start assist device once the apparatus detects or is signaled that the swimmer has left to prevent injuries and obstructions caused by the start assist device. A mechanical embodiment of such an apparatus and a motorized embodiment of such an apparatus with a data input system to position the start assist device according to the individual swimmers needs and means to signal the start event are disclosed.
US10245519B1
A toy vehicle that is operable to be manually propelled by a user across a surface wherein a user provides a propelling force through utilization of an applied force member secured to the toy vehicle. The toy vehicle includes a body having a rear end and a front end. Wheels are rotatably mounted proximate the rear end and the front end of the toy vehicle. An applied force member is secured to the rear end of the toy vehicle. The applied force member is semicircular in shape having an upper portion and lower portion that are contiguously formed. A void is present between the upper portion and the lower portion and an opening is further present being contiguous with the void. The applied force member has a first position and a second position. A user transitions the applied force member to its second position by applying a force to the upper portion and lower portion. Releasing the applied force member so as to return the applied force member to its second position provides directional movement of the toy vehicle.
