US08703992B2
Process for the preparation of aromatic and heteroaromatic carboxylic acids, carboxylic acid esters and carboxamides by the reaction of aromatic or heteroaromatic halides R—Xn, in which n=integer from 1 to 6, R=substituted or unsubstituted and aromatic or heteroaromatic radical and X=chlorine, bromine or iodine atom, with carbon monoxide and water, ammonia, alcohols or amines in the presence of bases and zero-valent or divalent palladium compounds and bidentate diphosphanes or complexes of zero-valent or divalent palladium with bidentate diphosphanes, in which use is made of bidentate diphosphanes (R1—)(R2—)P—Y—P(—R3)(—R4) in which R1 to R4=unsubstituted aryl radicals or aryl radicals substituted with at least one radical exhibiting a positive resonance effect or a positive inductive effect, or unsubstituted or substituted cycloalkyl radicals, and Y=hydrocarbon group with a total of 2 to 20 carbon atoms, in which at least one of the carbon atoms carries only one or no hydrogen atom as substituent; except for the reaction of 4-bromo-3-difluoromethyl-1-methylpyrazole with 2-(3,4,5-trifluorophenyl)aniline and carbon monoxide to give N-[2-(3,4,5-trifluorophenyl)phenyl]-3-difluoromethyl-1-methylpyrazole-4-carboxamide.
US08703991B2
A method for synthesizing (phenylalkyloxy)phenyl-oxobutanoic acid compounds is described. The corresponding (phenylalkyloxy)acylphenyl compound is halogenated, giving the alpha haloketone. The halide is displaced by the anion of a di-alkyl malonate to give a substituted malonic ester. Hydrolysis of the ester and decarboxylation of the diacid gives the desired product.
US08703985B2
The present invention is directed to a method for the preparation of ruthenium indenylidene carbene catalysts of the type (L)(L′)X2Ru(II)(aryl-indenylidene). The method comprises the steps of reacting the precursor compound Ru(PPh3)nX2 (n=3-4) with a propargyl alcohol derivative in an cyclic diether solvent such as 1,4-dioxane at temperatures in the range of 80 to 130° C. and reaction times of 1 to 60 minutes. Optionally, additional neutral electron donor ligands such as PCy3, phobane ligands or NHC ligands are added to the reaction mixture for ligand exchange. The method includes a precipitation step for purification, after which the product is isolated. The ruthenium-indenylidene carbene catalysts are obtained in high purity and are used as catalysts for metathesis reactions (RCM, ROMP and CM) and as precursors for the synthesis of modified ruthenium carbene catalysts.
US08703956B2
The invention relates to a stable amorphous form of (5-Fluoro-2-methyl-3-quinolin-2-ylmethyl-indol-1-yl)-acetic acid and its use in the treatment of conditions mediated by the action of PGD2 at the CRTH2 receptor.
US08703955B2
A process for the resolution of racemic tetrahydropapaverine with optically active arylpropionic acids is described.
US08703944B2
A method for preparing a rosuvastatin calcium intermediate represented by formula I. The method includes: hydrolyzing an ester compound represented by formula II (in which, R represents C1-C5) in the presence of a metal compound to obtain a carboxylic acid compound represented by formula III; and reducing the carboxylic acid compound in the presence of a reductant.
US08703941B2
The present invention provides thienopyrimidine and thienopyridine compounds, compositions thereof, and methods of using the same for the treatment of diseases mediated by IRAK enzymes. Such diseases include inflammatory and proliferative diseases.
US08703940B2
A process for the synthesis of 3,6-dihydro-1,3,5-triazine derivatives is claimed wherein a biguanid is reacted with acetaldehyde in the presence of an inorganic and/or organic base. The process can be carried out at mild and therefore economical reaction conditions.
US08703937B2
Improved methods for synthesizing bifunctional chelates of tetraazamacrocycle derivatives and intermediates thereof are disclosed as well as novel tetraazamacrocycle derivatives and intermediates thereof.
US08703936B2
Provided are modified cycloalkyne compounds; and methods of use of such compounds in modifying biomolecules. Embodiments include a cycloaddition reaction that can be carried out under physiological conditions. The cycloaddition reaction involves reacting a modified cycloalkyne with an azide moiety on a target biomolecule, generating a covalently modified biomolecule. The selectivity of the reaction and its compatibility with aqueous environments provide for its application in vivo and in vitro.
US08703932B2
Processes for preparing azacitidine. Further included are processes for the preparation of crystalline azacitidine crystalline Form I and mixtures of azacitidine crystalline Forms I and II.
US08703924B2
This invention relates to a cross-linkable chitosan composition comprising chitosan having a degree of deacetylation between 30 and 75%, wherein the chitosan is randomly deacetylated, and a cross-linking agent, wherein the molar ratio of the cross-linking agent to chitosan is 0.2:1 or less based on the number of functional groups in the cross-linking agent and the number of accessible amino groups in the chitosan. The invention also provides a chitosan hydrogel formed therefrom and uses thereof.
US08703911B2
The invention provides a pharmaceutical composition including a peptide comprising at least a portion of a chemokine receptor or a G-protein coupled receptor and optionally a cytokine. The pharmaceutical composition of the invention may be used for altering immune system functioning, for example, to treat an immune system disorder, such as an autoimmune disease, multiple sclerosis, transplant rejection, psoriasis and asthma. The invention also provides peptides that may be used in the pharmaceutical composition and a method for preparing the pharmaceutical composition of the invention. The invention further provides a method for to treating an immune system disorder, such as an autoimmune disease, multiple sclerosis, transplant rejection, and psoriasis asthma.
US08703904B2
The present invention relates to hydrogels and methods for producing and using the same. In particular, some embodiments of the invention relate to hydrogels and methods for patterning the same.
US08703899B2
The present invention relates to a method for producing a polyester, containing conducting a transesterification reaction of at least one compound selected from compounds represented by the following formulae (1) to (3) with a diol compound in the presence of a catalyst: wherein Ar is a divalent aromatic hydrocarbon group or the like; R1 is CX1Y1R4; R2 is a hydrogen atom or CX2Y2R5; R3 is a hydrogen atom or CX3Y3R6; R7 is a perfluoroalkylene group having 1 to 5 carbon atoms; X1 to X3 are a hydrogen atom, a fluorine atom or Rf; Y1 to Y3 are a fluorine atom or Rf; R4 to R6 are a fluorine atom, Rf, ORf or the like; and Rf is a fluoroalkyl group having 1 to 4 carbon atoms.
US08703895B2
Disclosed is a method and system for controlling the flow of an organic liquid by flowing an organic liquid through a pipe having an upstream end with an unconstricted portion and a downstream end with a constricted portion, the constricted portion having an inner diameter that is at least 10% smaller than the inner diameter of the unconstricted portion, and a porous plug formed of sol-gel derived particles in the pipe, the plug having a length at least two times the diameter of the pipe. Also disclosed is a method and system, the system including a housing having a liquid inlet and a liquid outlet and containing a sol-gel derived composition and a liquid pressure sensitive control means operatively connected to the liquid inlet for controlling the flow of the organic liquid, contacting the sol-gel derived composition to actuate the liquid pressure sensitive control means and controlling the flow of the organic liquid in response to the actuation.
US08703891B2
A contact lens formed of a composition comprising the reaction product of: A) at least 10 weight percent, based on the total composition weight excluding solvent, of at least one silicone-containing monomer of the formula I: where n is from 1 to 3, m is from 9 to 15, each a independently is C1-4 alkyl, and each b independently is C1-4 alkyl; B) at least 10 weight percent, based on the total composition weight excluding solvent, of 3-methacryloxypropyl tris(trimethylsiloxy)silane; C) N-vinyl pyrrolidone; and D) at least one other non-ionic hydrophilic monomer wherein the combined amount of A) and B) is at least 20 weight percent based on the total composition weight excluding solvent, and wherein the N-vinyl pyrrolidone (NVP) is present in such an amount that the reaction product comprises polyvinyl pyrrolidone (PVP) homopolymer.
US08703886B1
Disclosed herein are polymerization processes for the production of olefin polymers. These polymerization processes use a catalyst system containing at least two activator-supports. One activator-support is a halided solid oxide, and the other activator-support is a sulfated solid oxide and/or phosphated solid oxide.
US08703877B2
Described herein is a mixture comprising: a non-self-crosslinking polymer; and a modifying compound comprising at least two different functional groups. The first functional group of the modifying compound is capable of reacting with the non-self-crosslinking polymer and the second functional group is capable of crosslinking with a curing agent. Also, described are compositions, curable polymeric compositions, articles using such curable polymeric compositions, and methods of making cured polymeric compositions.
US08703874B2
The present invention relates to the use of a solid comprising at least one organosilane and a carrier material to hydrophobise mortars, wherein the organosilane has the formula R1Si(OR′)3 or R1R2Si(OR′)2 wherein R1 and R2 are the same or different and are a linear or branched C1- to C4-alkyl and/or alkenyl group, OR′ is an acetoxy, a C1- to C4-alkoxy and/or a C2- to C6-methoxyalkoxy and/or ethoxyalkoxy group, and the carrier material is a solid at room temperature. The amount of cement in the final formulation is zero or less than 5 wt.-%, based on the total weight of the final formulation in the dry and uncured form. Claimed are also a powder comprising the silane and a carrier with the carrier being a water-soluble polymer, dry mortar formulations containing no or less than 5 wt.-% cement, based on the dry weight of the uncured mortar formulation, as well as processes to manufacture the formulations and/or compounds.
US08703871B2
There is provided a polyolefin resin composition capable of affording molded articles being superior in tensile elongation at break and impact resistance. The composition includes not less than 1 wt % and less than 80 wt % of a propylene polymer (I) that is a propylene homopolymer or a copolymer of propylene and at least one comonomer, the copolymer having more than 0 wt % and less than 20 wt % of structural units derived from the at least one comonomer, not less than 1 wt % and less than 80 wt % of a propylene copolymer (II) having 20 to 80 wt % of structural units derived from the comonomer and/or an ethylene copolymer (III) having a density of less than 940 kg/m3, and more than 20 wt % and not more than 98 wt % of an ethylene polymer (IV) having an MFR of 12 to 100 g/10 minutes and a density of 940 to 970 kg/m3.
US08703866B2
A room temperature curable organopolysiloxane composition comprising (A) a diorganopolysiloxane, (B) an alkoxysilane compound and/or a partial hydrolytic condensate thereof, (C) a curing catalyst, and (D) an organic compound having at least one fatty acid ester radical —OC(═O)CH2R3 (wherein R3 is H or a monovalent hydrocarbon radical) and 0, 1 or 2 hydroxyl radicals effectively cures to glass and fluoropolymer-coated aluminum without a need for primer and has storage stability in a sealed package.
US08703853B2
Ethyleneamine polyphosphates are good flame retardants. Use of non viscous phase enables making modified ethyleneamine polyphosphate of enhanced thermal stability and greatly reduced waste stream. Addition of fillers such as fumed silica unexpectedly improve the flame retardance. Organic phosphates improve compatibility.
US08703839B2
Disclosed is an activation energy ray-curable resin composition comprising 70 to 95 parts by mass of a multifunctional monomer (A) which has a surface free energy of 37 mJ/m2 or more when cured and 5 to 30 parts by mass of a fluorine (meth)acrylate (B) which is compatible with the multifunctional monomer (A) (a total content of all monomers in the composition shall be 100 parts by mass), wherein the multifunctional monomer (A) has three or more radical polymerizable functional groups in a molecule and a value of a molecular weight thereof divided by the number of the radical polymerizable functional group (molecular weight/number of radical polymerizable functional group) is 110 to 200, and wherein the fluorine (meth)acrylate (B) has one or more radical polymerizable functional groups in a molecule.
US08703838B2
The invention provides an improved unsaturated polyester prepared from the polycondensation of unsaturated diacid monomers or unsaturated acid anhydride mononers and polyol monomers and, optionally, one or more saturated aliphatic or aromatic diacid monomers or anhydride monomers thereof. The improvement comprises 0.5 to 50 weight percent, based on the total monomer weight, of a hydroxyalkyl-functional siloxane of formula (1) below. The invention also relates to a UV curable coating formulation containing a siloxane-functional unsaturated polyester resin, a vinyl ether functional diluents and a photoinitiator. The invention further provides a method of preparing an article with a low-surface energy coating. According to the method, at least one surface of an article with a coating formulation of the invention; and the coating is then cured as described above with UV light to form a low-surface energy coating on the surface. The invention also relates to articles having a low-surface energy coating according to the invention.
US08703830B2
Disclosed is a process for the production of lower olefins by the conversion of a feed stream comprising carbon monoxide and hydrogen, and catalysts as used therein, such as a Fischer-Tropsch process. By virtue of the invention, lower olefins can be formed from synthesis gas, with high selectivity, and low production of methane. The catalysts used herein comprise an α-alumina support, and a catalytically active component that comprises iron-containing particles dispersed onto the support in at least 1 wt. %. The majority of the iron-containing particles is in direct contact with the α-alumina and is well-distributed thereon. Preferably, the iron-containing particles have an average particle size below 30 nm, and most preferably below 10 nm. The supported catalysts not only show a high selectivity, but also a high catalyst activity and chemical and mechanical stability.
US08703827B2
A foam for the treatment of varicose veins is disclosed, comprising a sclersosant solution, e.g. polidocanol, foamed with a gas mixture which includes greater than 41% of a lipid soluble gas such as xenon. The aim is to provide a foam which may be injected into a varicose vein in large quantities because the gas component is dissipated quickly after the foam has acted on the varicose vein.
US08703826B2
This disclosure concerns the discovery of (R,R)- and (R,S)-fenoterol analogues which are highly effective at binding β2-adrenergic receptors. Exemplary chemical structures for these analogues are provided. Also provided are pharmaceutical compositions including the disclosed (R,R)-fenoterol and fenoterol analogues, and methods of using such compounds and compositions for the treatment of cardiac disorders such as congestive heart failure and pulmonary disorders such as asthma or chronic obstructive pulmonary disease.
US08703825B2
Novel compounds of the following formula (I): in which: n represents an integer from 1 to 12, in particular from 1 to 8, m and m′ represent, independently of one another, integers from 0 to 8, q and q′ represent, independently of one another, integers from 0 to 2, p and p′ represent, independently of one another, integers from 0 to 4, A and A′ represent, independently of one another, a CH2 group, (particular case of amidines) an NH group or an NR″ group, in which R″ is a linear or branched alkyl group with 1 to 3 carbon atoms, B and B′ represent, independently of one another, an oxygen atom or a CH2 group, R and R′ are, independently of one another, a halogen, such as chlorine, bromine, iodine or fluorine atoms, or a linear or branched alkyl group with 1 to 3 carbon atoms, use thereof as medicaments and the method of preparation thereof.
US08703822B2
The present invention relates to a method of removing undifferentiated stem cells and dedifferentiated stem cells from a sample of cells. The invention further relates to preventing dedifferentiation of differentiated cells. Both methods comprise of administering to said cells an effective amount of compounds of formula (I): or a pharmaceutically acceptable salt thereof, wherein R1, R2, R3, n, p, Z and T are defined herein.
US08703816B2
Provided is a levodopa prodrug that overcomes the problems attributed to the blood kinetics of levodopa such as large number of doses and the incidence of side effects due to frequent dosing. (2S)-2-Amino-3-(3,4-bis((2-(benzoyloxy)-2-methylpropanoyl)oxy)phenyl)propanoic acid, a salt thereof, or a solvate thereof is a levodopa prodrug, and provides a flat blood concentration-time profile of levodopa through oral administration, and therefore is useful as a preventive and/or therapeutic agent for Parkinson's disease and/or Parkinson's syndrome that overcomes the problems associated with pharmaceutical preparations of levodopa.
US08703800B2
Nitrate ester and diazeniumdiolate derivatives of pioglitazone are described. They have valuable properties in the treatment of vascular and metabolic diseases, for example type 2 diabetes.
US08703799B2
Disclosed herein are non-competitive NMDA receptor antagonists having chemical structures similar to that of phencyclidine (PCP). These antagonists contain a polycyclic ring structure in place of the cycloalkyl ring of PCP. The antagonists also differ from PCP in that they include an electron withdrawing group, a hydroxyl group, or an amine group at the para position of the phenyl ring. The antagonists disclosed herein are useful for treating or ameliorating a symptom of ailments associated with over excitation of cells (e.g., neurons) that express NMDA receptors. Examples of ailments that can be treated and for which symptoms can be ameliorated include epilepsy, neurodegenerative disease (e.g., Alzheimer's and Parkinson's diseases), drug addiction, neuropathic pain, and neuronal and glutamate-dependent tumors.
US08703795B2
The present invention relates to novel compounds capable of modulating the stability and/or activity of hypoxia inducible factor (HIF).
US08703784B2
This invention relates to novel fused tricyclic compounds under Formula I that are inhibitors of mammalian Target of Rapamycin (mTOR) kinase, which is also known as FRAP, RAFT, RAPT or SEP, and are useful in the treatment of cellular proliferative diseases, for example cancer and other proliferative disorders.
US08703783B2
The present invention relates to purinone derivatives which are agonists of the HM74a receptor. Further provided are compositions and methods of using the compounds herein, and their pharmaceutically acceptable salts for the treatment of disease.
US08703770B2
The present invention is directed to pyridazine carboxamide compounds which are antagonists of orexin receptors, and which are useful in the treatment or prevention of neurological and psychiatric disorders and diseases in which orexin receptors are involved. The invention is also directed to pharmaceutical compositions comprising these compounds and the use of these compounds and compositions in the prevention or treatment of such diseases in which orexin receptors are involved.
US08703769B2
Methods of treating or preventing obesity or obesity related disorders in a subject are provided, comprising administering to the subject a treatment effective in reducing one or more activities of an epidermal growth factor receptor (EGFR) in the subject. Methods of screening for compositions that can modulate one or more EGFR activities are also provided.
US08703768B2
The invention is concerned with novel nitrogen-containing heteroaryl compounds of formula (I) wherein A1, A2, R1, R2, R3, R4, R5 and R6 are as defined in the description and in the claims, as well as physiologically acceptable salts and esters thereof. These compounds inhibit PDE10A and can be used as therapeutics.
US08703766B2
The present invention provides methods of use of oxadiazoanthracene derivatives of the formula (I) and pharmaceutically acceptable salts thereof, wherein A, B, C, R, R1, R2, R3, R4 and R5 are as herein described, and wherein said methods of use include uses for the treatment of disorders and diseases, such as diabetes.
US08703761B2
The invention relates to compounds of formula (I): where A is an optionally substituted heteroaryl, useful for treating disorders mediated by acyl coA-diacylglycerol acyl transferase 1 (DGAT1), e.g. metabolic disorders. The invention also provides methods of treating such disorders, and compounds and compositions etc. for their treatment.
US08703756B2
A method of reducing the in vivo viability of cancer cells selected from the group consisting of breast cancer cells, lung cancer cells, prostate cancer cells and melanoma cancer cells has steps of: a) identifying a prospective patient having cancer cells selected from the group consisting of breast cancer cells, lung cancer cells, prostate cancer cells and melanoma cancer cells; and b) administering a cisplatin derivative to the prospective patient so that the cisplatin derivative will contact the cancer cells; wherein the cisplatin derivative is a 4,4′-bis[RO]-2,2′-bipyridine)PtCl2 where, R is selected from the group consisting of —(CH2)nCH3 where n=2, 3, 4 or 5, and —(CH2)n[O(CH2)m]yO(CH2)zCH3 where n=2, m=2, y=2, z=1. A novel synthetic process for the manufacture of these compounds (and their analogs) is also provided.
US08703746B2
The present invention relates to novel derivatives, processes for preparing them, pharmaceutical compositions containing them and their use as pharmaceuticals as modulators of sphingosine-1-phosphate receptors.
US08703745B1
The present invention relates to novel amine derivatives, processes for preparing them, pharmaceutical compositions containing them and their use as pharmaceuticals as modulators of sphingosine-1-phosphate receptors.
US08703742B2
This invention relates to, among other items, benzoxaborole compounds and their use for treating bacterial infections.
US08703737B2
Disclosed are nutritional compositions including human milk oligosaccharides in combination with long chain polyunsaturated fatty acids and/or carotenoids that can be administered to preterm infants, term infants, toddlers, and children for reducing inflammation and the incidence of inflammatory diseases.
US08703734B2
The disclosure provides probes for one or more target molecules. In particular examples, the probes include a molecular linker and first and second functional groups linked and spaced by the molecular linker, wherein the functional groups are capable of interacting with one another or with the target biomolecule in a predetermined reaction, and wherein the molecular linker maintains the first and second functional groups sufficiently spaced from one another such that the functional groups do not substantially interact in an absence of the target biomolecule. In the presence of the target biomolecule the functional groups interact (with each other, with the target biomolecule, or both), and in some examples a detectable signal is produced. In some examples, the functional groups can detect or modify a target molecule. Also provided are methods of using the probes, for example to detect or modify a target molecule.
US08703724B2
The present invention relates to formulations comprising an anthracycline compound and an aromatic or heterocyclic compound.
US08703721B2
The present invention relates to an arylalkylamine compound represented by the following formula [I] or a pharmaceutically acceptable salt thereof, a process for preparing the same, and use of the above-mentioned compound as an activating compound (CaSR agonist) of a Ca sensing receptor, a pharmaceutical composition containing the above-mentioned compound as an effective ingredient, etc.
US08703717B2
The present invention relates to compositions comprising growth hormone linked to extended recombinant polypeptide (XTEN), isolated nucleic acids encoding the compositions and vectors and host cells containing the same, and methods of making and using such compositions in treatment of growth hormone-related diseases, disorders, and conditions.
US08703716B2
The invention provides methods and compositions for improving fetal and child health and development through nutritional supplementation with, for example, sialic acid. Sialic acid can be provided to a female before, during and/or after pregnancy to improve the health and development of a fetus and/or child. The sialic acid can be in a variety of forms in the supplements.
US08703712B2
Provided is a method of determining the level of resistance or sensitivity of cancer stem cells to a death receptor agonist. The method includes detecting the level of IAP in one or more DR5/DDX3/IAP complexes in or from the cancer stem cells. Also provided is a method of killing cancer stem cells in a subject and a method of reducing the risk of cancer recurrence in a subject.
US08703711B2
Methods, uses, agents and compositions useful for the prevention, treatment and/or diagnosis of neuroinflammatory conditions such as multiple sclerosis and spinal cord injury based on the modulation of nerve injury-induced protein-1 (Ninjurin-1) are disclosed.
US08703708B2
Methods of treating solid organ injuries using compounds that enhance Wnt signalling are described.
US08703705B2
The present invention provides peptides at least partly derivable from FVIII which are capable of binding to an MHC class II molecule without further antigen processing and being recognized by a factor VIII specific T cell. In particular, the present invention provides a peptide comprising or consisting of the sequence EDNIMVTFRNQASR. The present invention also relates to the use of such a peptide for the prevention or suppression of inhibitor antibody formation in haemophilia A and/or acquired haemophilia.
US08703704B2
A treatment method effective for promoting hair growth utilizes atrial natriuretic peptide.
US08703698B2
Peptides and mimetics of selected domains of mammalian serum amyloid A isoform 2.1 (SAA2.1) and compounds and compositions thereof are provided that enhance the effect on macrophage cholesterol ester hydrolase activity and/or inhibit acyl CoA:cholesterol acyl transferase activity. Methods of using these compositions in the treatment and/or prevention of atherosclerosis as well as coronary heart disease and cardiovascular disease are also provided.
US08703689B2
The present invention provides an aqueous bleaching composition comprising from about 1.0% to 10.0% by weight of alkali metal hypochlorite, from about 0.05% to 5.0% by weight of alkali metal hydroxide to provide the composition with a pH in the range of from about 9 to 14; from about 0.02% to 5.0% by weight of a metal silicate or mixtures of metal silicates; from about 0.0001% to 0.2% by weight of a metal periodate; and water. The compositions reliably protect the fabric against yellowing and weakening while providing protection to stainless steel metal parts of the washing machine and metal garment decors such as buckles, buttons, etc.
US08703684B2
Provided is a water-based lubricant comprising a hyperbranch-type polyglycerol having an absolute molecular weight of from 5,000 to 500,000. The water-based lubricant has a small friction coefficient and is excellent in lubrication performance and defoamability, as compared with conventional water-based lubricants comprising an ethylene/propylene oxide copolymer, and is favorable, for example, for a water-based metal processing agent and a hydraulic pressure fluid.
US08703680B2
Disclosed are friction modifier compositions and a method of lubricating an internal combustion engine, comprising supplying to said engine an oil of lubricating viscosity and from 0.25 to 5 weight percent based upon the total mass of the lubricating oil composition of a friction modifier composition containing: a) an amino alcohol reaction product prepared by isomerizing a C12-C30 normal alpha olefin using at least one of a solid or liquid catalyst to form an internal olefin; epoxidizing said olefin; and reacting with a mono-hydroxyl amine; b) an ester of glycerol and a C12-C22 carboxylic acid containing 0 to 3 double bonds.
US08703669B2
The present disclosure provides a fluid for lubricating the clutch-only portion of a wet clutch in a dual clutch transmission. The fluid provides high dynamic friction durability and comprises an oil of lubricating viscosity formulated with additive components comprising: i) at least one metal detergent; ii) at least one phosphorus-based wear preventative; iii) a phosphorylated and boronated dispersant different than the at least one phosphorus-based wear preventative; iv) a sulfurized extreme pressure agent; and a ratio between the content (ppm) of the sulfur based on the total weight of the fluid composition and a content (ppm) of phosphorus based on the total weight of the fluid composition ranging from about 2.0 to about 0.5 (ppm/ppm).
US08703667B2
The passage of a container along a conveyor is facilitated by applying to the container or conveyor aqueous compositions containing hardness ions. The compatibility of the aqueous compositions with PET bottles is improved when the ratio of hardness as CaCO3 to alkalinity as CaCO3 is greater than about 1 to 1.
US08703666B2
Provided is a method for stabilizing a dispersion of a carbon nanomaterial in a lubricating oil basestock. The method includes providing a lubricating oil basestock; dispersing a carbon nanomaterial in the lubricating oil basestock; and adding at least one block copolymer thereto. The at least one block copolymer has two or more blocks includes at least one alkenylbenzene block and at least one linear alpha olefin block. The at least one block copolymer is present in an amount sufficient to stabilize the dispersion of the carbon nanomaterial in the lubricating oil basestock. Also provided is a lubricating engine oil having a composition including: a lubricating oil base stock; a carbon nanomaterial dispersed in the lubricating oil basestock; and at least one block copolymer.
US08703661B2
Components, turbochargers, and methods of forming components are provided. In an embodiment, by way of example only, a method of forming a component is provided. The method includes applying a plurality of coated particles to a substrate, wherein each coated particle comprises a solid film lubricant particle and a layer surrounding an entire surface of the solid film lubricant particle, each solid film lubricant particle comprises at least one compound, and the layer comprises a coating material having a greater resistance to oxidation than the compound when subjected to a predetermined processing temperature and heating the substrate to the predetermined processing temperature to form a portion of a coating over the substrate.
US08703651B2
A composition of matter for a layered ionic superconductor comprising a plurality of layers of ions and electronic interaction charges, and having a substantially improved superconducting transition temperature is described. An aspect of the composition includes a first layer comprising a plurality of alkali ions and cesium ions in particular that is adjacent to a second layer comprising a plurality of halogen ions and fluorine ions in particular. The first and second layers contain electronic interaction charges and are separated by a predetermined perpendicular distance. Crystalline structure, ionic properties, superconducting transition temperature, and superfluid density for several embodiments including companion ionic species are described and illustrated. Methods for preparing the several embodiments are provided.
US08703647B2
The present disclosure relates to a color-changing composition and to a substrate having the color-changing compositions disposed thereon. The color-changing composition includes a leuco dye, a color-developer and a desensitizer. The color-changing composition changes from a colorless or largely colorless composition to color upon being wetted with an aqueous liquid. The color-changing composition remains colorless or largely colorless prior to exposure to high relative humidity conditions.
US08703644B2
Aspects of the present invention relate to shaped bodies of compositions comprising a porous aromatic covalent framework polymer, wherein the polymer comprises at least one monomer unit, the at least one monomer unit comprising at least one aromatic ring and the at least one monomer unit having at least three binding sites to adjacent monomer units in the polymer and a core, wherein the at least three binding sites are located on at least one atom of the core and wherein the at least one atom is free of covalent bonds to hydrogen; and at least one binder additive. Other aspects of the invention relate to methods for the preparation of said shaped bodies and their uses.
US08703641B2
In a process for forming a bulk hydroprocessing catalyst by sulfiding a catalyst precursor made in a co-precipitation reaction, up to 60% of the metal precursor feeds end up in the supernatant. The metals can be recovered via any of chemical precipitation, ion exchange, electro-coagulation, and combinations thereof to generate an effluent stream containing less than 50 mole % of metal ions in at least one of the metal residuals, and for at least one of the metal residuals recovered as a metal precursor feed for use in the co-precipitation reaction. In one embodiment, the resin functions as an anion exchange resin with an acidic supernatant to recover Group VIB metal residuals, and a cation exchange resin with a basic supernatant to recover Promoter metal residuals. An effluent stream from the process to waste treatment contains less than 50 ppm metals.
US08703635B2
This disclosure relates to a catalyst composition comprising (a) MCM-22 family material; and (b) a binder comprising at least 1 wt. % of a titanium compound based on the weight of said catalyst composition, wherein said titanium compound was anatase and rutile phases.
US08703634B2
Hemostatic compositions comprising a wet layered clay (e.g., wet kaolin) and, optionally, a zeolite, as well as devices and methods of use to promote blood clotting, are provided.
US08703622B2
A flat panel display device includes a substrate having a display unit, a metal sealing substrate including a first metal layer, a second metal layer, and an insulating layer therebetween, a sealing member between the substrate and the metal sealing substrate, and a power supply device including a magnet, the power supply being positioned on the metal sealing substrate and further including a first power supply unit configured to supply a first power to the first metal layer of the metal sealing substrate, a second power supply unit configured to supply a second power to the second metal layer of the metal sealing substrate, and an insulating unit between the first power supply unit and the second power supply unit, the insulating unit being configured to insulate the first and second power supply units from each other.
US08703619B2
A method of taper-etching a layer to be etched that is made of a dielectric material and has a top surface. The method includes the steps of: forming an etching mask with an opening on the top surface of the layer to be etched; and taper-etching a portion of the layer to be etched, the portion being exposed from the opening, by reactive ion etching so that a groove having two wall faces intersecting at a predetermined angle is formed in the layer to be etched. The step of taper-etching employs an etching gas containing a first gas contributing to the etching of the layer to be etched and a second gas contributing to the deposition of a sidewall protective film, and changes, during the step, the ratio of the flow rate of the second gas to the flow rate of the first gas so that the ratio increases.
US08703613B2
A base material is placed on a base material placement face of a base material placement table. An inductively coupled plasma torch unit is structured with a cylindrical chamber structured with a cylinder made of an insulating material and provided with a rectangular slit-like plasma jet port, and lids closing opposing ends of the cylinder, a gas jet port that supplies gas into the cylindrical chamber, and a solenoid coil that generates a high frequency electromagnetic field in the cylindrical chamber. By a high frequency power supply supplying a high frequency power to the solenoid coil, plasma is generated in the cylindrical chamber, and the plasma is emitted from the plasma jet port to the base material. While relatively shifting the plasma torch unit and the base material placement table, a base material surface can be subjected to heat treatment.
US08703609B2
A method of fabricating a semiconductor device including providing a substrate having a front surface and a back surface. A masking element is formed on the front surface of the substrate. The masking element includes a first layer having a first opening and a second layer having a second opening of a greater width than the first opening. The second opening is a tapered opening. The method further includes etching a tapered profile via extending from the front surface to the back surface of the substrate using the formed masking element.
US08703607B2
A method of manufacturing a semiconductor device is described. The method comprises performing a gas cluster ion beam (GCIB) pre-treatment and/or post-treatment of at least a portion of a silicon-containing substrate during formation of a silicide region.
US08703603B2
Provided are methods of forming sealed via structures. One method involves: (a) providing a semiconductor substrate having a first surface and a second surface opposite the first surface; (b) forming a layer on the first surface of the substrate; (c) etching a via hole through the substrate from the second surface to the layer, the via hole having a first perimeter at the first surface; (d) forming an aperture in the layer, wherein the aperture has a second perimeter within the first perimeter; and (e) providing a conductive structure for sealing the via structure. Also provided are sealed via structures, methods of detecting leakage in a sealed device package, sealed device packages, device packages having cooling structures, and methods of bonding a first component to a second component.
US08703601B2
Disclosed are an application method, device and program which enable the constant retention of a fillet shape, without altering the shape due to the speed differences associated with changes in the direction of the nozzle or differences in the degree of penetration when bumps are arranged non-uniformly. In a liquid material application method a desired application pattern is created, liquid material is discharged from a nozzle whilst the nozzle and a workpiece are moved relative to one another, and the gap between a substrate and the workpiece, the workpiece being placed above the substrate by means of at least three bumps, is filled up with liquid material by capillary action. If bumps are arranged non-uniformly, the supply quantity per unit area of the application pattern is set so that a greater quantity is supplied to application areas next to areas where the integration density of bumps is high, than is supplied to application areas next to areas where the integration density of bumps is low.
US08703593B2
A method of forming an integrated circuit includes providing a semiconductor wafer including a semiconductor fin dispatched on a surface of the semiconductor wafer; forming a dopant-rich layer having an impurity on a top surface and sidewalls of the semiconductor fin, wherein the impurity is of n-type or p-type; performing a knock-on implantation to drive the impurity into the semiconductor fin; and removing the dopant-rich layer.
US08703587B2
A method of manufacturing of a semi-conductor element, comprising the following steps: providing a substrate, the substrate having a surface, the surface being partially coated with a coating and having at least one uncoated area, and growing a truncated pyramid of gallium nitride on the uncoated area, wherein the method comprises the following step: growing at least one gallium nitride column on the truncated pyramid.
US08703575B2
The instant disclosure relates to a method of forming an isolation area. The method includes the steps of: providing a substrate having a first type of ion dopants, where the substrate has a plurality of trenches formed on the cell areas and the isolation area between the cell areas of the substrate, with the side walls of the trenches having an oxidation layer formed thereon and the trenches are filled with a metallic structure; removing the metallic structure from the trenches of the isolation area; implanting a second type of ions into the substrate under the trenches of the isolation area; and filling all the trenches with an insulating structure, where the trenches of the isolation area are filled up fully by the insulating structure to form a non-metallic isolation area.
US08703571B2
A method of forming a semiconductor device is provided. The method includes forming a first fin above a substrate, forming a first emitter region in a first portion of the first fin, forming a first collector region in a second portion of the first fin, and forming a first base region in a third portion of the first fin. The third portion of the first fin is disposed underneath a first gate electrode. The method further includes forming a second fin adjacent to the first fin and above the substrate. The second fin is composed of a semiconductor material. The method also includes forming a first base contact over the second fin. The first base contact is coupled to the first base region through the second fin, the substrate, and the first fin.
US08703568B2
The present invention is a method for forming super steep doping profiles in MOS transistor structures. The method comprises forming a carbon containing layer (110) beneath the gate dielectric (50) and source and drain regions (80) of a MOS transistor. The carbon containing layer (110) will prevent the diffusion of dopants into the region (40) directly beneath the gate dielectric layer (50).
US08703567B2
The present invention discloses a method for manufacturing a semiconductor device, comprising: forming an insulating isolation layer on a substrate; forming an insulating isolation layer trench in the insulating isolation layer; forming an active region layer in the insulating isolation layer trench; forming a semiconductor device structure in and above the active region layer; characterized in that the carrier mobility of the active region layer is higher than that of the substrate. Said active region is formed of a material different from that of the substrate, the carrier mobility in the channel region is enhanced, thereby the device response speed is improved and the device performance is enhanced. Unlike the existing STI manufacturing process, for the present invention, an STI is formed first, and then filling is performed to form an active region, thus avoiding the problem of generation of holes in STI, and improving the device reliability.
US08703566B2
A memory device includes an array of memory cells and peripheral devices. At least some of the individual memory cells include carbonated portions that contain SiC. At least some of the peripheral devices do not include any carbonated portions. A transistor includes a first source/drain, a second source/drain, a channel including a carbonated portion of a semiconductive substrate that contains SiC between the first and second sources/drains and a gate operationally associated with opposing sides of the channel.
US08703565B2
An integrated circuit structure includes a substrate and a germanium-containing semiconductor fin over the substrate. The germanium-containing semiconductor fin has an upper portion having a first width, and a neck region under the upper portion and having a second width smaller than the first width.
US08703559B2
The present invention discloses a thin-film transistor (TFT) array substrate and a manufacturing method thereof. Depositing a transparent conductive layer and a first metal layer in turn on a substrate patterned by a first multi-tone mask (MTM) to form a gate, a common electrode and a reflecting layer; depositing a gate insulation layer and a semiconductor layer patterned by a second MTM to remain the semiconductor layer on the gate; and depositing a second metal layer patterned by a third MTM to form a source and a drain.
US08703556B2
A FinFET device is fabricated by first receiving a FinFET precursor. The FinFET precursor includes a substrate and fin structures on the substrate. A sidewall spacer is formed along sidewall of fin structures in the precursor. A portion of fin structure is recessed to form a recessing trench with the sidewall spacer as its upper portion. A semiconductor is epitaxially grown in the recessing trench and continually grown above the recessing trench to form an epitaxial structure.
US08703550B2
A shallow trench is formed to extend into a handle substrate of a semiconductor-on-insulator (SOI) layer. A dielectric liner stack of a dielectric metal oxide layer and a silicon nitride layer is formed in the shallow trench, followed by deposition of a shallow trench isolation fill portion. The dielectric liner stack is removed from above a top surface of a top semiconductor portion, followed by removal of a silicon nitride pad layer and an upper vertical portion of the dielectric metal oxide layer. A divot laterally surrounding a stack of a top semiconductor portion and a buried insulator portion is filled with a silicon nitride portion. Gate structures and source/drain structures are subsequently formed. The silicon nitride portion or the dielectric metal oxide layer functions as a stopping layer during formation of source/drain contact via holes, thereby preventing electrical shorts between source/drain contact via structures and the handle substrate.
US08703549B2
An oxide or nitride semiconductor layer is formed over a substrate. A first conductive layer including a first element and a second element, and a second conductive layer including the second element are formed over the semiconductor layer. The first element is oxidized or nitrogenized near an interface region between the first conductive layer and the oxide or nitride semiconductor layer by heat treatment or laser irradiation. The Gibbs free energy of oxide formation of the first element is lower than those of the second element or any element in the oxide or nitride semiconductor layer.
US08703547B2
The present invention provides a device for electrostatic discharge and the method of manufacturing thereof. P-well is formed on the substrate, and a first N+ doped region, a second N+ doped region and a P+ doped region are formed in the P-well; both ends of each doped region adopt shallow trench isolation for isolation. A lightly doped source-drain region portion is formed between the first N+ doped region and the shallow trench isolation connected thereto. Under the source-drain region, a halo injection with an inverse type is formed. The reverse conduction voltage of the collector of the bipolar transistor is lowered through the introduction of special doped region and the adoption of lightly doped source-drain technology for manufacturing the source-drain region as well as the manufacturing of halo injection with inverse type under the source-drain region, thus reducing the trigger voltage of the device.
US08703538B2
A method of manufacture of an integrated circuit packaging system includes: providing a package carrier; mounting an integrated circuit to the package carrier; forming an external wire on the package carrier and adjacent to the integrated circuit; forming an encapsulation on the package carrier over the external wire; and forming a hole in the encapsulation with the external wire and a portion of the package carrier exposed from the encapsulation.
US08703534B2
A method of forming semiconductor assemblies is disclosed. The method includes providing an interposer with through interposer vias. The interposer includes a first surface and a second surface. The through interposer vias extend from the first surface to the second surface of the interposer. A first die is mounted on the first surface of the interposer. The first die comprises a first surface with first conductive contacts thereon. The interposer comprises material with coefficient of thermal expansion (CTE) similar to that of the first die. The first conductive contacts of the first die are coupled to the through interposer vias on the first surface of the interposer.
US08703530B2
A method of manufacturing an organic EL element operating at low voltage to emit light at high intensity comprises: a first step of forming, on an anode, a hole injection layer including metal oxide; a second step of irradiating the hole injection layer with ultraviolet light, the ultraviolet light having a wavelength greater than a wavelength at which oxygen molecules decompose and yield oxygen radicals; a third step of forming functional layers containing organic material on or above the hole injection layer after the second step, the functional layers including a light-emitting layer; and a fourth step of forming a cathode on or above the functional layers.
US08703521B2
A method for fabrication of a multijunction photovoltaic (PV) cell includes providing a stack comprising a plurality of junctions on a substrate, each of the plurality of junctions having a respective bandgap, wherein the plurality of junctions are ordered from the junction having the smallest bandgap being located on the substrate to the junction having the largest bandgap being located on top of the stack; forming a top metal layer, the top metal layer having a tensile stress, on top of the junction having the largest bandgap; adhering a top flexible substrate to the metal layer; and spalling a semiconductor layer from the substrate at a fracture in the substrate, wherein the fracture is formed in response to the tensile stress in the top metal layer.
US08703520B2
Disclosed are: a printing plate having improved productivity; and a method for manufacturing a solar cell element, which uses the printing plate. A printing plate according to one embodiment of the present invention comprises: a metal plate; a buffer layer that is arranged on one main surface of the metal plate; and a slit that penetrates through the metal plate and the buffer layer. The slit has a first penetrating part that is located in the metal plate, a second penetrating part that is located in the buffer layer, and a bridge that is arranged inside and across the first penetrating part. When viewed in plan from the above-mentioned main surface side, the buffer layer-side opening edge of the first penetrating part is inside the metal plate-side opening edge of the second penetrating part.
US08703511B2
A light emitting device is manufactured in which a cap having a frame portion is bonded to a package having a light emitting element mounted in a recess of the package to cover an opening of the recess. A method for manufacturing the light emitting device includes: partially disposing a metal bonding agent, having greater wettability to the frame portion than to the package, to one of the package and the frame portion; and bonding the package and the frame portion by extending the metal bonding agent along the frame portion so that ends of the metal bonding agent are joined to each other while defining a space at a joining portion where the ends of the metal bonding agent are joined.
US08703497B2
A system and method for analyzing nucleic acids is presented herein. The system can include a nanowire assembly including a plurality of nanowires. In some embodiments, at least two nanowires can be coupled to a different probe corresponding to a different sequence version of a polymorphism. The system can include a reagent delivery system capable of delivering a template polymorphic nucleotide, an extension nucleic acid, and an enzyme to the nanowire assembly. The system can include an electrical detector configured to measure an electrical characteristic of the nanowire assembly and/or a controller in communication with the reagent delivery system. In some embodiments, the electrical detector can be configured to collect data corresponding to changes in the electrical characteristic in response to contact with the template polymorphic nucleotide, the extension nucleic acid, and the enzyme.
US08703495B2
A blood coagulation detection device includes a micro channel unit, an optical signal unit, an opto-electronic conversion circuit, an amplifier circuit, and a filter circuit. The micro channel unit has a sample detection area. The optical signal unit transmits a reference light to the micro channel unit so as to form a message light. The opto-electronic conversion circuit receives the message light and converts the message light into an electrical signal. The amplifier circuit is electrically connected to the opto-electronic conversion circuit for amplifying the electrical signal. The filter circuit is electrically connected to the amplifier circuit for filtering the amplified electrical signal.
US08703489B2
Disclosed herein are methods and compositions for generating a single-stranded break in a target sequence, which facilitates targeted integration of one or more exogenous sequences.
US08703486B2
This application relates to an in vitro method of producing a polyclonal IgG preparation. The method comprises (i) placing a polyclonal B-cell population enriched in IgG-secreting B cells in a culture medium; and (ii) culturing the polyclonal B-cell population under conditions enabling the production of the polyclonal IgG preparation from the polyclonal B-cell population. This improved method enables the production of antibodies (preferably IgG) and facilitates long-term culture of polyclonal B-cell populations.
US08703479B2
A method is provided for co-culturing viable cells and microorganisms for at least 48 hours in which an adhesion module is provided including a basal compartment and a luminal compartment separated by a semi-permeable membrane, and a continuous or semi-continuous flow of fresh medium is applied to the basal compartment.
US08703470B2
Embodiments of the invention relate to the microbial production of polyhydroxyalkanoic acids, or polyhydroxyalkanoates (PHA), from substrates which cannot be used as a source of carbon and/or energy for microbial growth or PHA synthesis and which have microbial and environmental toxicity. According to one embodiment of the invention, a process for the production of PHA is provided wherein an enzyme such as methane monooxygenase is used to convert volatile organic compounds into PHA through the use of microorganisms that are unable to use volatile organic compounds as a source of carbon for growth or PHA production.
US08703465B2
A truncated pullulanase variant of a parent pullulanase belonging to family GH57 comprising an X47 domain and the use thereof.
US08703460B2
In a method for producing an additive for the enzymatic degradation of mycotoxins, in particular fumonisins, it is provided that at least one nucleic acid sequence of genes corresponding to sequences ID Nos. 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 is provided, the at least one nucleic acid sequence is expressed in prokaryotic or eukaryotic host cells, and at least one thus prepared enzyme corresponding to sequences ID Nos. 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23 and 25, or at least one complete recombinant host organism optionally along with a cosubstrate, are used in a vegetable raw material.
US08703459B2
Disclosed are mutants of galactosyltransferases that can catalyze formation of oligosaccharides in the presence of magnesium; mutants of galactosyltransferases having altered donor and acceptor specificity which can catalyze formation of oligosaccharides in the presence of magnesium; methods and compositions that can be used to synthesize oligosaccharides; methods for increasing the immunogenicity of an antigen; and methods to stabilize platelets.
US08703433B2
An object is to provide a biomarker specific to amyotrophic lateral sclerosis and a use thereof. Provided are a marker for amyotrophic lateral sclerosis containing a transmembrane glycoprotein nmb, and a method for detecting amyotrophic lateral sclerosis, which utilizes the marker, and the like.
US08703431B2
The invention relates to novel polypeptides and to the use thereof for the in vitro assessment of the sensitizing potential of a test compound, to a method for the in vitro assessment of the sensitizing potential of a test compound, to an in vitro method for selecting a compound suitable for reducing the sensitization, as well as to kits for implementing such methods.
US08703428B2
The disclosure provides a system and method for characterizing a single live-cell response to a stimulus with a biosensor imaging system having cells immobilized on the biosensor at a resolution level of a single cell, as defined herein.
US08703420B2
The invention relates to an in vitro method for the detection of bacteria of the Salmonella spp. genus by means of a quantitative polymerase chain reaction using specific primers for the pathogen from DNA and RNA samples from the microorganism. The method is useful in the detection of viable and non-viable microorganisms of Salmonella spp. in environmental, clinical and food samples. Likewise, the invention also relates to a kit used for putting the method into practice.
US08703417B2
The invention is directed to enhanced methods for detecting an analyte of interest in situ, by immunoassay, or by hybridization comprising binding an enzyme-labeled conjugate molecule to an analyte of interest in the presence of a redox-inactive reductive species and a soluble metal ion. The enzyme catalyzes the conversion of the inactive reductive species to an active reducing agent, which in turn reduces the metal ion to a metal atom thereby providing an enhanced means of detecting the analyte via metal deposition.
US08703412B2
A method for measuring LAM and a method for detecting an acid-fast bacterium, which comprise at least a step of allowing a Limulus reagent to contact with a LAM-containing sample; a method for removing reactivity of LAM with a Limulus reagent, which comprises at least a step of allowing a predetermined substance to coexist with a LAM-containing sample; a method for measuring Et in a LAM-containing sample and a method for detecting an Et-related disease, which each is a method for measuring an endotoxin using a Limulus reagent, which comprises at least a step of removing reactivity of LAM with a Limulus reagent by the above-described removing method; a method for measuring BG in a LAM-containing sample and a method for detecting mycosis, which is a method for measuring BG using a Limulus reagent, which comprises at least a step of removing reactivity of LAM with a Limulus reagent by the described-described removing method; and the like.
US08703408B2
A pattern is formed by coating a resist composition comprising a polymer comprising recurring units having an acid labile group-substituted hydroxyl group and recurring units having an acid labile group-substituted carboxyl group, an acid generator, and an organic solvent onto a substrate, prebaking to form a resist film, exposing the resist film to high-energy radiation, PEB, and developing the exposed film two times with an organic solvent and an alkaline aqueous solution. Due to the two developments, one line is divided into two lines, achieving a resolution doubling the mask pattern.
US08703403B2
The present disclosure provides a method of fabricating a semiconductor device. The method includes dispensing a liquid on a wafer. The method includes raising the wafer. The method includes lowering the wafer after the raising. The wafer is spun as it is lowered, thereby removing at least a portion of the liquid from the wafer. The present disclosure also provides an apparatus for fabricating a semiconductor device. The apparatus includes a wafer chuck that is operable to hold a semiconductor wafer and secure the wafer thereto. The wafer has a front surface and a back surface. The apparatus includes a dispenser that is operable to dispense a liquid to the front surface of the wafer. The apparatus includes a mechanical structure that is operable to: spin the wafer chuck in a horizontal direction; and move the wafer chuck downwards in a vertical direction while the wafer chuck is being rotated.
US08703397B1
A method for fabricating a side shield for a magnetic transducer is described. The magnetic transducer has a nonmagnetic layer and a pole on the nonmagnetic layer. The pole has sidewalls and an air-bearing surface location (ABS location) corresponding to an air-bearing surface (ABS). A developable bottom antireflective coating (D-BARC) layer covering the pole and at least a portion of the nonmagnetic layer is provided. The D-BARC layer is photosensitive. A photosensitive mask layer is provided on the D-BARC layer. A first portion of the mask layer and a first portion of the D-BARC layer are removed to form a bi-layer mask. The bi-layer mask has an aperture in the mask layer and the D-BARC layer. At least one side shield layer is deposited. At least a portion of the at least one side shield layer resides in the aperture. The bi-layer mask is also removed.
US08703394B2
The present disclosure is a method for forming a thin film pattern to form a micron-pattern and a flat display device having the same. The method for forming a thin film pattern includes the steps of forming first to third thin film layers on a substrate in succession, forming a first photoresist pattern on the third thin film layer, patterning the second and third thin film layers using the first photoresist pattern as a mask to form first and second thin film mask pattern having line widths different from each other, forming a second photoresist pattern at a region where the first and second thin film mask patterns do not overlap positioned between the first thin film layer and the second thin film mask pattern, removing the first and second thin film mask patterns, and patterning the first thin film layer using the second photoresist pattern as a mask.
US08703391B1
A polymeric matrix material exhibits low loss at optical frequencies and facilitates the fabrication of all-dielectric metamaterials. The low-loss polymeric matrix material can be synthesized by providing an unsaturated polymer, comprising double or triple bonds; partially hydrogenating the unsaturated polymer; depositing a film of the partially hydrogenated polymer and a crosslinker on a substrate; and photopatterning the film by exposing the film to ultraviolet light through a patterning mask, thereby cross-linking at least some of the remaining unsaturated groups of the partially hydrogenated polymer in the exposed portions.
US08703390B2
A method of making a flexographic printing sleeve form includes the steps of forming a sleeve body by providing one or more at least partially cured uniform layers on a sleeve carrier; forming a relief image on the sleeve body by imagewise jetting a curable jetting fluid; and optionally overall post-curing; characterized in that between formation of the sleeve body and formation of the relief image no polishing or grinding is performed.
US08703389B2
In a method for fracturing or mask data preparation or mask process correction for charged particle beam lithography, a plurality of shots are determined that will form a pattern on a surface, where shots are determined so as to reduce sensitivity of the resulting pattern to changes in beam blur (βf). At least some shots in the plurality of shots overlap other shots. In some embodiments, βf is reduced by controlling the amount of shot overlap in the plurality of shots, either during initial shot determination, or in a post-processing step. The reduced sensitivity to βf expands the process window for the charged particle beam lithography process.
US08703387B2
A resist composition comprising a base component (A) which exhibits changed solubility in a developing solution under action of acid and an acid-generator component (B) which generates acid upon exposure, the acid-generator component (B) comprising an acid generator (B1) composed of a compound represented by general formula (b1-1) shown below [wherein, X represents a cyclic group of 3 to 30 carbon atoms which may have a substituent, provided that a ring skelton of the cyclic group contains an —SO2— bond or an —O—SO2— bond, and at least one carbon atom which is not adjacent to the —SO2— bond or the —O—SO2— bond has an oxygen atom as a substituent; Q1 represents a divalent linking group or a single bond; Y1 represents an alkylene group which may have a substituent or a fluorinated alkylene group which may have a substituent; and A+ represents an organic cation]. [Chemical Formula 1] X-Q1-Y1—SO3⊖A⊕ (b1-1)
US08703368B2
A process for use in lithography, such as photolithography for patterning a semiconductor wafer, is disclosed. The process includes receiving an incoming semiconductor wafer having various features and layers formed thereon. A unit-induced overlay (uniiOVL) correction is received and a deformation measurement is performed on the incoming semiconductor wafer in an overlay module. A deformation-induced overlay (defiOVL) correction is generated from the deformation measurement results by employing a predetermined algorithm on the deformation measurement results. The defiOVL and uniiOVL corrections are fed-forward to an exposure module and an exposure process is performed on the incoming semiconductor wafer.
US08703353B2
A separator for a fuel cell includes a flow field plate and a main body plate. The flow field plate has a porous plate structure and is bonded to an outer surface of a gas diffusion layer to form a reaction gas flow field. The main body plate is bonded to an outer surface of the flow field plate to seal the reaction gas flow field. The flow field plate has protrusions that protrude from both surfaces of the flow field plate in a repetitive pattern, forming an uneven structure. The flow filed plate has a land portion bonded to the gas diffusion layer at a sharp tip of a protrusion thereof protruding from one surface of the flow field plate and a bonding portion bonded to the main body plate at an opposite sharp tip of a protrusion thereof protruding from the other surface of the flow field plate.
US08703350B2
The present invention provides a heat-resistant alloy member which hardly causes external diffusion of Cr, an alloy member for a fuel cell, a collector member for a fuel cell, a cell stack, and a fuel cell apparatus.The surface of a collector base material 201 containing Cr is coated with a Cr diffusion preventing layer 203 made of an oxide containing Zn and Mn and a coating layer 202 made of an oxide containing Zn is formed on the surface of the Cr diffusion preventing layer 203. The coating layer 202 preferably contains at least one kind of Al and Fe as a trivalent or higher valent positive metal element.
US08703348B2
The cooling device of the present invention is intercalated to the fuel cells assembled in a stack and comprises a planar, elastically deformable, conductive and porous element capable of ensuring both the passage of a suitable coolant and the electrical continuity between the walls delimiting the same. The planar conductive deformable and porous element is characterized by being provided with linear sections capable of guiding the coolant flow so as to reliably achieve a uniform heat withdrawal. The linear sections may have a straight shape and consist of inert impervious and preferably elastic material.
US08703335B2
A lithium mixed metal oxide comprising Ni, Mn and Fe and having a BET specific surface area of 2 m2/g or more and 30 m2/g or less. A method of producing a lithium mixed metal oxide, comprising bringing an aqueous solution containing Ni, Mn, Fe and Cl into contact with an alkali to obtain a coprecipitate, and calcining a mixture of the coprecipitate and a lithium compound by maintaining the mixture at a temperature of lower than 900° C. A positive electrode active material for nonaqueous electrolyte secondary battery, comprising the lithium mixed metal oxide described above or the lithium mixed metal oxide obtained by the method of producing a lithium mixed metal oxide described above as a main ingredient. A positive electrode for nonaqueous electrolyte secondary battery having the positive electrode active material for nonaqueous electrolyte secondary battery described above.
US08703323B2
Disclosed is a separator. The separator includes a planar non-woven fabric substrate having a plurality of pores, and a porous coating layer formed on at least one surface of the non-woven fabric substrate. The porous coating layer is composed of a mixture of filler particles and a binder polymer. The filler particles include conductive positive temperature coefficient (PTC) particles composed of a mixture of conductive particles and a low melting point resin having a melting point lower than that of the non-woven fabric substrate. Due to the presence of the conductive PTC particles, the porous coating layer can be imparted with a shutdown function against thermal runaway. In addition, the porous coating layer exhibits appropriate electrical conductivity. Therefore, the separator is suitable for use in a high-capacity electrochemical device.
US08703322B2
Disclosed herein is a battery cartridge having a plate-shaped battery cell mounted therein, wherein the battery cartridge includes a pair of plate-shaped frames configured to fix opposite sides of the battery cell at the edge thereof in a state in which the sides of the battery cell are open, and each of the frames is provided at the inside thereof, disposed in contact with the edge of the battery cell, with an elastic pressing member configured to press the edge of the battery cell.
US08703313B2
Disclosed are a separator for a battery and a battery. The separator includes a porous film, a first roller, and a second roller. The first and second rollers are associated with both ends of a porous film. The first roller is wound with a portion of the porous film and is configured to rotate to unroll the film. The second roller is configured to rotate in an opposite direction to a rotary direction of the first roller to roll up the film.
US08703307B2
According to one embodiment, a perpendicular magnetic recording medium includes a soft magnetic underlayer formed above a substrate, a lower seed layer formed above the soft magnetic underlayer, at least one upper seed layer formed above the lower seed layer, an interlayer formed above the at least one upper seed layer, a perpendicular recording layer formed above the interlayer, and a protective layer formed above the perpendicular recording layer, wherein the at least one upper seed layer comprises Ni or a Ni based alloy including N, and wherein the lower seed layer includes Ni and at least one element selected from a group consisting of: W and Cr. Other embodiments are described herein regarding perpendicular magnetic recording systems and methods of producing perpendicular magnetic media.
US08703303B2
Disclosed is an organic electroluminescent device (organic EL device) that is improved in the luminous efficiency, fully secured of the driving stability, and of a simple structure. The organic EL device comprises a light-emitting layer between an anode and a cathode piled one upon another on a substrate and the said light-emitting layer comprises (A) a phosphorescent dopant whose emission peak wavelength is longer than 600 nm and (B) a host material. The host material contains at least two kinds of compounds selected from two or more kinds of derivatives included in (b1) N-substituted indolocarbazole derivatives, (b2) derivatives of 8-hydroxyquinoline aluminum complex, and (b3) bisindolocarbazole derivatives.
US08703300B2
Disclosed is a long-life organic electroluminescent element which can be driven at low voltage. Also disclosed are a display and illuminator using the same. Specifically disclosed is an organic electroluminescent element comprising on a substrate, an anode, a cathode and an organic compound layer arranged between the anode and the cathode and including at least one light emission layer. This organic electroluminescent element is characterized in that the organic compound layer includes an electron transport material-containing layer which contains an electron transport material represented by Formula (a) and at least one substance selected from the group consisting of metals, salts of the metals and electron-donating compounds. Formula (a) Ar1-(Ar2)n [In the formula, Ar1 represents a group derived from an aromatic hydrocarbon ring or a group derived from an aromatic heterocycle; Ar2 represents a group derived from an aromatic heterocycle; and n represents an integer of 2 or more.
US08703298B2
The gas-barrier film of the present invention basically comprises a polymer of a polyvalent metal salt of an unsaturated carboxylic acid compound which gives an infrared absorption spectrum in which the ratio of the absorbance A0 at around 1,700 cm−1 attributable to V C═O of the carboxylic acid group to the absorbance A at around 1,520 cm−1 attributable to V C═O of the carboxylate ion, A0/A, is lower than 0.25, and this gas-barrier film and a gas-barrier layered body having the film can be manufactured by applying a solution of a polyvalent metal salt of an unsaturated carboxylic acid compound having a degree of polymerization lower than 20 to at least one side of a substrate layer and then polymerizing the polyvalent metal salt of the unsaturated carboxylic acid compound.
US08703291B2
The present teachings provide a fuser member. The fuser member includes a substrate layer and a surface layer disposed on the substrate layer. The substrate layer comprises a plurality of core-shell particles wherein the core is a conductive particle and the shell is a fluoroplastic dispersed in a fluoroelastomer.
US08703288B2
Cable coatings having effective low-smoke emission, fire resistance and moisture resistance provided by a single layer are described. The cable coatings contain an base polymer, a oxygen containing ethylene copolymer, a fire retardant and a synergistic blend of magnesium hydroxide and aluminum hydroxide. Cables coated with the described coatings have improved wet electrical performance, and satisfactory fire performance and smoke characteristics.
US08703284B1
An amalgam comprising a highly porous, carbon-enveloped structure, such as aerogel. The carbon dispersion within the aerogel substrate consists of sonicated (using ultrasonic cleanser) carbon nanotubes, which can be inserted into the aerogel/xerogel through various techniques. Procedures include mixture of nanotubes to any aerogel/xerogel preparation solution prior and/or during solgel/alcogel stage; addition of nanotubes to aerogel during any solvent exchange with liquids (ethanol, etc.) or gas (carbon dioxide, etc.) as a solgel/alcogel; permeation of vapor containing nanotubes (by way of carbon burning using the Kratschmer-Huffman, or any other related, similar machine) in aerogel/solgel/alcogel/xerogel pore structure and/or preparation solutions; intravenous introduction of nanotubes, manually or by way of any conveyance device (i.e. syringe) to finished aerogels/xerogels or solgels/alcogels.
US08703277B2
Provided is a curable resin composition which can provide a cured article having a low dielectric constant and a low dielectric tangent, and can also provide a cured article having excellent moldability at ordinary press-molding temperatures, excellent heat resistance and excellent adhesion properties. The present invention provides a curable resin composition containing a polyphenylene ether, wherein the average number of phenolic hydroxy groups is 0.3 or more per molecule of the polyphenylene ether, the resin flow amount of the curable resin composition upon curing is 0.3 to 15% inclusive, and a cured article having a dielectric tangent of 0.005 or less at 1 GHz and a glass transition temperature of 170° C. or higher can be produced.
US08703272B2
A composite of a metal part and a resin composition part that is improved so that the metal and resin are integrally joined to have strong bonding properties, and a method for manufacturing the composite. A magnesium alloy part is inserted into a mold, a resin composition is injected and joined to the part, and a composite is obtained. A part having, formed thereon, a surface layer of a metal oxide, a metal carbonate, or a metal phosphate in use of a usual conversion treatment or a modification method thereof can be used for the magnesium alloy plate 1. The surface that has a larger amount of crystal-like objects of a nanolevel on the surface layer composed of the metal oxide, metal carbonate, or metal phosphate has a higher level of hardness, microscopic roughness, and good injection joining force, and these parameters can be controlled by a conversion treatment method. A resin composition 4, containing PBT or PPS as the main component, is used as the resin composition part.
US08703265B2
A holographic sealing member for a container including a heat actuated sealant or adhesive layer that secures the sealing member to a container. The sealing member also includes a metal foil sealing layer over and covering and bonded to the heat actuated sealant or adhesive layer, a holographic layer over and covering and bonded to the metal foil layer having an upper plastic layer and a lower embossed image layer, and a tab over and covering and bonded to the upper plastic layer. The tab may be pulled to remove the tab and the plastic layer from a container, thereby exposing the lower embossed image layer which may then be perforated to gain access to the contents of the container.
US08703258B1
The present invention describes a nucleating agent tailored specifically to the thermal energy storage medium lithium nitrate trihydrate (LiNO3-3H2O), and to the use thereof. Addition of the nucleating agent copper hydroxy nitrate hydrate [Cu3(OH)5(NO3)-2H2O](Likasite) suppresses the undercooling in lithium nitrate trihydrate, forming a superior composite thermal energy storage medium.
US08703254B2
An adaptable three-dimensional ornamental wire frame model includes a head, a neck, a body and various appendages. The various appendages are mounted to the body or to each other by pivot joints that permit pivoting of the appendages relative to the body and/or to each other. The model is adaptable to posing in multiple ornamental positions and configurations as desired by the user. Preferably, lights on a light string are mounted on the adaptable three-dimensional ornamental wire frame model to outline the shape of the model.
US08703252B2
A multi-layer stretched film has 251 or more alternating layers which consist of first layers and second layers, wherein the first layers are made of a polyester which contains (i) 5 to 50 mol % of a naphthoic acid component as a dicarboxylic acid component and (ii) a diol having an alkylene group with 2 to 10 carbon atoms as a diol component; and the second layers are made of a thermoplastic resin having an average refractive index of 1.50 to 1.60 and differences in refractive index among a uniaxial stretching direction, a direction orthogonal to the uniaxial stretching direction and a film thickness direction of 0.05 or less before and after stretching, and the film has specific reflectance characteristics for a P polarization component and an S polarization component.
US08703251B2
A method and apparatus are provided for growing a composite metal sulphide photcatalyst thin film, wherein photochemical deposition and chemical bath deposition are both performed for growing the composite metal sulphide thin film, such as (AgInS2)x/(ZnS)2(1-x), wherein x is 0-1.
US08703246B2
A coating method forming a coating film having a predetermined film thickness on a band-like support body. The method includes conveying the band-like support body; forming the coating liquid on the band-like support body using a coating device fixed on an vibration isolation device; and detecting vibration components on a surface of a floor on which the coating device is disposed and controlling vibration of the active vibration isolation device.
US08703245B2
A coated metal substrate has at least one layer of titanium based hard material alloyed with at least one alloying element selected from the list of chromium, vanadium and silicon. The total quantity of alloying elements is between 1% and 50% of the metal content, the layer having a general formula of: (Ti100-a-b-cCraVbSic)CxNyOz.
US08703235B2
In the method of embodiments of the invention, the metal seeded carbon allotropes are reacted in solution forming zero valent metallic nanowires at the seeded sites. A polymeric passivating reagent, which selects for anisotropic growth is also used in the reaction to facilitate nanowire formation. The resulting structure resembles a porcupine, where carbon allotropes have metallic wires of nanometer dimensions that emanate from the seed sites on the carbon allotrope. These sites are populated by nanowires having approximately the same diameter as the starting nanoparticle diameter.
US08703232B2
The present disclosure describes an article and a method of forming a microstructure. The method includes providing a substrate having a structured surface region comprising one or more recessed features with recessed surfaces. The structured surface region is substantially free of plateaus. The method includes disposing a fluid composition comprising a functional material and a liquid onto the structured surface region. The method includes evaporating liquid from the fluid composition. The functional material collects on the recessed surfaces such that a remainder of the structured surface region is substantially free of the functional material.
US08703231B2
A lead for painting includes a water-insoluble lead basic mass in which a water-soluble dye is present. A method of painting with a lead is also provided.
US08703230B2
Systems and methods for molding shells for fluid-filled prosthetic implants, including spinning and rotating dip- or spray-mandrels during a devolatilization step to ensure an even covering. The mandrels may be spun during the dipping or spraying step, and/or afterward while a solvent evaporates until a gum state is formed. The techniques are particularly useful for forming hollow shells from silicone dispersions for soft implants, such as breast implants.
US08703226B2
A method improving the textural attributes of baked snack foods. The method comprises mixing ingredients, extruding the ingredients to form a collet, hydrating the collet with a hydrating fluid to form a hydrated collet, and baking the hydrated collet. The hydrating fluid can comprise water, oil, a surfactant, an emulsifier, and mixtures thereof. In one embodiment the baking comprises utilizing an impingement oven. The method discussed herein more resembles the taste and texture of a fried product than does prior art baking methods.
US08703221B2
The invention relates to a method for preparing food products by co-extrusion, comprising of producing the food product from a filler mass and a casing mass which is liquid prior to the co-extrusion, wherein the casing mass comprises at least collagen and alginate. The invention also relates to a food product obtained by co-extrusion, comprising a meat mass and a casing, wherein the casing comprises at least collagen and alginate.
US08703217B2
A stabilized, natural biogenerated cheddar flavor component, which may be used to prepare food products having flavor characteristics of traditional style cheeses, and a process for manufacturing the biogenerated cheddar flavor component is provided. The cheese flavor component is stabilized against the growth of spoilage or pathogenic microorganisms therein. The stabilized cheese flavor component is achieved by addition of a bacteriocin source as part of the fermentation process that accelerates at least part of the fermentation time needed for flavor development. Inclusion of secondary microbial barriers are also provided for. Therefore, production times can be significantly reduced for the flavor component of the present invention without loss of flavor and while improving microbial stability. The flavor component can be used in process cheese, process cheese-type products, or other cheeses. The flavor component can also be used as a natural flavoring system in other food products. Methods of making and using the flavor component in food products, such as cheese products, are also provided.
US08703216B2
Provided are engineered meat products formed as a plurality of at least partially fused layers, wherein each layer comprises at least partially fused multicellular bodies comprising non-human myocytes and wherein the engineered meat is comestible. Also provided are multicellular bodies comprising a plurality of non-human myocytes that are adhered and/or cohered to one another; wherein the multicellular bodies are arranged adjacently on a nutrient-permeable support substrate and maintained in culture to allow the multicellular bodies to at least partially fuse to form a substantially planar layer for use in formation of engineered meat. Further described herein are methods of forming engineered meat utilizing said layers.
US08703208B2
The invention disclosed a novel mesoporous silica-based xerogel and its use in hemorrhage control. The mesoporous silica-based xerogel material has tunable mesopores (1-50 nm), high specific surface area (100-1400 m2/g), macroscopical morphology (powder, film, disc, column, etc.) and adjustable compositions (SiO2, CaO and P2O5, etc.) as well as good biodegradation. The mesoporous silica-based xerogels herein effectively promote the blood clotting under various conditions including slow and severe hemorrhage, even at the blood oozing site of bone defect. Meanwhile, the networks of silica-based xerogel with good elastic and mechanic properties, formed by adsorbing a large amount of water, can modulate the cell behavior and tissue growth, and thus promote the wound healing. Additionally, due to the mesoporous structure, the materials have the potential to load drug, thrombin and bioactive factors, which is favorable for the therapeutical efficacy.
US08703206B2
Described herein are tissue grafts derived from the placenta. The grafts are composed of at least one layer of amnion tissue where the epithelium layer has been substantially removed in order to expose the basement layer to host cells. By removing the epithelium layer, cells from the host can more readily interact with the cell-adhesion bio-active factors located onto top and within of the basement membrane. Also described herein are methods for making and using the tissue grafts. The laminin structure of amnion tissue is nearly identical to that of native human tissue such as, for example, oral mucosa tissue. This includes high level of laminin-5, a cell adhesion bio-active factor show to bind gingival epithelia-cells, found throughout upper portions of the basement membrane.
US08703203B2
The invention relates to an oral dosage form containing deferasirox, binder, disintegrant and optionally wicking agent, wherein the introduction of the dosage form into water leads to a suspension wherein the suspended particles have an average particle size (D50) of 20 μm to 120 μm, and also to a method of producing it.
US08703195B2
Disclosed is a method in which poloxamer, a resin, and/or a tocopherol is/are fused, and the material that is to be treated is intimately dispersed with said melt. After being introduced into the melt, the material that is to be treated is coated with water to prevent hardening, and the spontaneously forming gel is homogenized. The obtained product is composed of a transparent gel that is based on at least one poloxamer, a resin or a tocopherol, and an active substance which is solubilized, dispersed, and stabilized therein and whose consistency ranges from solid, semisolid, i.e. aspic-like, to liquid. The micelles of said solubilized matter remain stable even when the same is diluted well below the CMC of poloxamer.
US08703192B2
Dosage forms for the oral administration of the magnesium salt of pantoprazole are described.
US08703181B2
The present invention provides liposome compositions containing substituted ammonium and/or polyanion, and optionally with a desired therapeutic or imaging entity. The present invention also provides methods of making the liposome compositions provided by the present invention.
US08703180B1
Disclosed are compositions with sustained-release carriers associated with at least two different types of growth factors and methods of fabrication and treatments thereof. In some embodiments, simultaneous release of the growth factors may be preferred while in other embodiments, sequential release of the growth factors may be preferred. Application of at least two growth factors to an injury site, e.g., compromised cardiac tissue caused by, for example, myocardial infarction or ischemic heart failure, may better mimic and induce the complex growth factor signaling pathways necessary to improve cardiac function. When applied to a patient after a myocardial infarction or ischemic heart failure, multiple growth factors within a sustained-release carrier platform or platforms may cause a synergistic effect on injected cells intending to alleviate left ventricle remodeling. Methods of treatment include percutaneous, sub-xiphoid, and open chest methods using catheters and/or syringes.
US08703175B2
Compositions and methods for controlling drug loss and delivery in transdermal drug delivery systems
A transdermal delivery system is provided for the topical application of one or more active agents contained in one or more polymeric and/or adhesive carrier layers, proximate to a non-drug containing polymeric and/or adhesive coating that is applied to either the transdermal system's backing or release liner. The transdermal delivery device is manufactured to optimize drug loading while providing desirable adhesion to skin or mucosa as well as providing modulation of the drug delivery and profile.
US08703174B2
A pet supplement includes a joint preserving and joint rebuilding composition comprising chicken collagen type II, glucosamine hydrochloride and chondroitin sulfate, a vitamin composition comprising vitamins C, D and K, a mineral composition comprising calcium, magnesium, zinc, copper, manganese and boron, a herbal anti-oxidant cofactor blend comprising citrus bioflavonoids, red grapes anthocyanins, turmeric rhizome, boswellia resin and fennel seed. Each of these ingredients is intimately mixed into the pet supplement and orally delivered to the pet in the form of a segment, paste or powder having a size and weight or other dosage measuring feature adjusted in accordance with the pet's weight. A synergistic action between these ingredients preserves and rebuilds the pet's joints, and is nutritionally beneficial for the pet.
US08703169B1
The present invention provides an implantable device having a coating including a slow dissolving polymer or material and the methods of making and using the same.
US08703166B1
Antimicrobial and algaecidal products are disclosed. In general, the antimicrobial or algaecidal products can be adhered to structural components of buildings and include particles that, when combined with water, produce a solution that is toxic to organisms such as algae. The products provide an algaecidal wash as water percolates on, or through the product, and can prevent or control growth of unsightly algae and other microbes.
US08703163B2
Silicone elastomer spherical particles having a volume mean particle size of 0.1-100 μm are coated with a polyorganosilsesquioxane and washed with alcohol or a mixture of alcohol and water. The coated fine particles are water repellent so that they are non-dispersible in water and float on water.
US08703160B2
A composition comprising: an adduct of a vegetable oil and maleic anhydride; and a material chosen from a hydrolyzed keratin, hydroxyethyl urea, and/or a quaternized nitrogen moisturizing agent.
US08703158B2
The present invention is theobromine as an active agent to be delivered via the inhaled route, for the treatment of cough.
US08703156B2
An oral pharmaceutical liquid formulation comprising deferiprone and a taste masking composition, said taste masking composition comprising an effective amount of a sweetener (such as sucralose) per liter of liquid composition, an effective amount of a thickening and suspension aid, (for example hydroxyethylcellulose), per liter of liquid composition, an effective amount of a humectant (such as glycerin) per liter of liquid composition, and an effective amount of at least one flavoring agent, wherein a final form of said taste-masked pharmaceutical has a substantially non-bitter and palatable taste.
US08703151B2
The invention is related to an immunogenic composition, vaccine or pharmaceutical composition for preventing, boosting or treating infection caused by a species of the tuberculosis complex (M. tuberculosis, M. Bovis, M. africanum, M. microti). The immunogenic composition, vaccine or pharmaceutical composition comprise a fusion polypeptide, which comprises one or more starvation antigens from M. tuberculosis, the units of the fusion polypeptide being M. tuberculosis antigens. Further, the invention is related to the use of a vaccine comprising a fusion polypeptide sequence or nucleic acid sequence of the invention given at the same time as BCG, either mixed with BCG or administered separately at different sites or routes for preparing said immunogenic composition, vaccine, or pharmaceutical composition.
US08703147B2
The present invention provides compositions and methods useful in the treatment or prevention of a condition caused by or associated with infection by Plasmodium falciparum, such as malaria. The compositions include various antigens of Plasmodium falciparum, both alone and in combination. The invention further includes fragments of the antigens.
US08703146B2
The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:49) or EQAAKTTENPLQKIDAALAQVDTLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:50), or a modification thereof. Further provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAE ITQ (SEQ ID NO:44) and substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. Methods of using immunomodulatory flagellin peptides additionally are provided.
US08703139B2
Disclosed are monoclonal antibodies, binding fragments, and derivatives thereof directed to the human melanocortin-4 receptor, as well as pharmaceutical compositions including the same, the therapeutic uses, including methods for treating cachexia and related conditions and diseases, using such monoclonal antibodies, binding fragments, derivatives, and pharmaceutical compositions.
US08703138B2
Disclosed are pharmaceutical compositions comprising a CIRP inhibitor. A method of treating a subject suffering from an inflammatory condition comprising administering to said subject a CIRP inhibitor is also described herein.
US08703130B2
The present invention relates to bispecific antibodies against human VEGF and against human ANG-2, methods for their production, pharmaceutical compositions containing said antibodies, and uses thereof.
US08703123B2
Provided is a method of obtaining biologically active recombinant human G-CSF from inclusion bodies, wherein the solubilization and refolding process can be performed at ambient temperature and the purification step comprises reversed phase chromatography (RP), in particular RP-HPLC. The G-CSF preparation so obtained is characterized by high purity and homogeneity.
US08703120B2
The invention, in some aspects, relates to the selective killing of cancer stem cells by oncolytic Herpes virus mediated oncolysis. In some aspects, the invention relates to methods for treating a subject having a cancer stem cell by administering to the subject an oncolytic Herpes virus. In other aspects, the invention provides methods for evaluating the efficacy of an oncolytic Herpes virus for killing cancer stem cells.
US08703116B2
The present invention relates to a macromolecule having a controlled terminal group stoichiometry, the macromolecule including a surface layer, at least one subsurface layer and at least two terminal groups including: a first terminal group which is a residue of a pharmaceutically active agent, a derivative thereof or precursor therefor; and a second terminal group selected to modify the pharmacokinetics of the pharmaceutically active agent and/or macromolecule, wherein terminal group stoichiometry refers to the number and type of terminal groups.
US08703115B2
The present invention provides pharmaceutical compositions comprising a pharmaceutically acceptable excipient and a conjugate having a degradable linkage. The conjugates include at least one of each the following: an aromatic moiety comprising an ionizable hydrogen atom, a spacer moiety, and a water-soluble polymer. Methods for delivering such compositions are also provided.
US08703106B2
Methods for administration of a substantially non-cytotoxic chlorine dioxide composition to whiten a tooth surface are provided. The method comprises contacting a surface of a tooth with an efficacious amount of a composition comprising chlorine dioxide to provide an efficacious amount of chlorine dioxide to the tooth surface, wherein the contacting step comprises one or more of: i) contacting the tooth surface iteratively with at least two, substantially contiguous applications of a substantially non-cytotoxic composition comprising chlorine dioxide; ii) irrigating the tooth surface using an irrigation device that delivers a substantially non-cytotoxic composition comprising chlorine dioxide, or iii) irrigating the tooth surface using an irrigation device that comprises a chlorine dioxide composition comprising a cytotoxic amount of oxy-chlorine anions; and an oxy-chlorine anion barrier, wherein the irrigation devices delivers a substantially oxy-chlorine anion free chlorine dioxide composition to the tooth surface.
US08703096B2
Novel derivatives of imidazopyridinylbenzeneamines and novel derivatives of benzothiazolylbenzeneamines are disclosed that offer improved behavior when used as imaging agents for positron emission tomography of beta-amyloids. Also disclosed is a palladium-catalyzed reaction scheme under microwave conditions for aryl thioethers in general that provides a high ratio of substitution relative to reduction and can be used for the imidazopyridinylbenzeneamine derivatives as well as other compounds of related structure.
US08703086B2
A method for producing phosphates and/or compounds containing phosphates is provided, in particular alkaline-earth phosphates, alkaline-earth silicophosphates, and alkaline-earth oxides, comprising the following steps: (a) heating bones and/or fish bones or a composition of said components in a pyrolysis process in the absence of oxygen and under reductive conditions at temperatures between 500 and 1100° C., wherein among other things high-energy gases, vapors, and carbon are produced, (b) subsequently combusting the carbon produced in step (a) under oxidative conditions in an oxidation step, wherein an inorganic radical of alkaline-earth carbonates, alkaline-earth oxides, and alkaline-earth phosphates is produced.
US08703082B2
The present invention relates to a method for capturing CO2 from exhaust gas in an absorber (A1), wherein the CO2 containing gas is passed through an aqueous absorbent slurry wherein said aqueous absorbent slurry comprises an inorganic alkali carbonate, bicarbonate and at least one of an absorption promoter and a catalyst, and wherein the CO2 is converted to solids by precipitation in the absorber, said slurry having the precipitated solids is conveyed to a separating device (F1), in which the solids are separated off, essentially all of at least one of the absorption promoter and catalyst is recycled together with the remaining aqueous phase to the absorber.
US08703065B2
A production saltwater disposal facility comprising a separator configured to receive production saltwater from a pipeline or a vehicle and separate hydrocarbons from the production saltwater, wherein the production saltwater received from the pipeline or vehicle is substantially the same composition as when the production saltwater was located in a subterranean formation, a hydrocarbon storage tank configured to receive hydrocarbons from the separator, a settling pit configured to receive the production saltwater from the separator and separate metals and/or other solids from the saltwater, an evaporator in fluid communication with the settling pit and comprising a nozzle configured to emit a stream of the saltwater along a path in air such that water in the saltwater evaporates, and a collection pit positioned under the path and configured to collect the salt from the saltwater after the water has evaporated.
US08703057B2
An electronic device for analyzing an aqueous solution may comprise a housing, one or more measurement circuits and a control circuit all arranged inside the housing. The housing may be configured to receive a test element. The one or more measurement circuits may be configured to produce one or more corresponding sets of measurement signals relating to an aqueous solution received on the test element. The control circuit may include a memory having instructions stored therein that are executable by the control circuit to process the one or more sets of measurement signals to determine one or more corresponding characteristics of the aqueous solution.
US08703054B2
The present invention relates to analytical apparatus comprising: a passage (45) in which an analytical tool (2) is moved from above to below; and a movement block (51), made capable of reciprocatory movement in the horizontal directions (D1, D2), for moving the analytical tool (2) incoming through the passage (45) in the direction (D1). This analytical apparatus is constructed such that, by erecting the analytical tool (2) on the movement block (51) positioned directly below the outlet (45B) of the passage (45) and causing the movement block (51) to move in the D1 or D2 direction, the analytical tool (2) is tipped over, and the analytical tool (2) is placed in a horizontal condition on the movement block (51).
US08703053B2
Antiseptic compositions comprising at least one salt of EDTA are disclosed. These compositions have broad spectrum antimicrobial and antifungal activity and they also have anticoagulant properties. The antiseptic compositions have also demonstrated activity in penetrating and breaking down microbial slime, or biofilms. They are safe for human and medical uses and may be used as prophylactic preparations to prevent infection, or to reduce the proliferation of and/or eliminate existing or established infections.
US08703045B2
The present invention relates to a method of manufacturing a multiple composition component 10, comprising: arranging first, second and third constituent parts 40, 30, 42 having first, second and third compositions respectively A, B, C so that the first constituent part 40 shares a first boundary with the second constituent part 30 and the second constituent part 30 shares a second boundary with the third constituent part 40. The first, second and third constituent parts 40, 30, 42 are each either a powder or a solid so that the first and second boundaries are each a solid adjacent to a powder. The arrangement is then processed so as to form a single solid component having first, second and third regions 16, 18, 20 having first, second and third compositions A, B, C respectively.
US08703042B2
A method and system for method for removing solid accretions from a copper anode or holding furnace using coherent jet lance assembly directed towards the solid accretions in the bottom portion of the copper anode furnace to melt the solid accretions over an extended period of time without damage to the furnace refractory proximate a point of stream impingement.
US08703040B2
The present invention relates to a method of manufacturing a piezoelectric ceramic body and devices therefrom. The method comprises mixing a piezoelectric ceramic powder with a polymer binder and surfactant to form a slip mixture, casting the slip mixture into a mold and setting to the slip mixture in the mold to form a green body, cutting the green body to form a cut green body with an array of micron-sized ceramic elements and separation, and sintering the cut green body to form a sintered ceramic body. The sintered ceramic body can be further process to encasing in a polymer material to form a piezoelectric ceramic-polymer composite. The piezoelectric ceramic-polymer composite can be further processed to form devices such as acoustic transducers and sensors.
US08703032B2
The effectiveness of biomimetic dry adhesives at different ambient pressures is investigated. Biomimetic dry adhesives have great potential for space applications but there have been few studies on how these adhesives perform in low-pressure environments. Various geometrical configurations for cap and fiber structures of dry adhesive materials are disclosed. Various methods for manufacturing dry adhesive materials including a silicone rubber negative mold are disclosed. Various methods of manufacturing directly molded anisotropic dry adhesive structures with anisotropic peel strengths are also provided.
US08703031B2
The subject of the invention is a method for the manufacture of briquettes from comminuted straw, as well as a device to manufacture briquettes from comminuted straw. The method consists in that comminuted straw is compressed in a continuous process using a screw-type extruder until the material reaches a temperature at which the material after pressing solidifies to a density exceeding 1.3 g/cm 3. The device has a screw (3) composed of three segments of decreasing helix pitches toward the outlet. The forming die (8) is housed in a tank (11) connected through a water system (12) to a cooler (13). The cooling system has a temperature sensor (17) installed, said sensor being part of the pump supply circuit (15).
US08703025B2
The present invention relates to a method for the manufacture of a contact lens with a printed image thereon, in particular a silicone hydrogel contact lens with a printed image thereon, comprising applying one or more ink drops to at least a portion of at least one molding surface of a lens mold, wherein each ink drop is sufficiently flat, that the forces exerted by the mold surface to the ink drop surface in the area where they make contact, are higher than the forces exerted by the flowing lens forming material to the facing surface of the ink drop, and wherein the ink material and the lens forming material are sufficiently immiscible or not miscible at all.
US08703023B2
A plasma treatment has been used to modify the surface of BNNTs. In one example, the surface of the BNNT has been modified using ammonia plasma to include amine functional groups. Amine functionalization allows BNNTs to be soluble in chloroform, which had not been possible previously. Further functionalization of amine-functionalized BNNTs with thiol-terminated organic molecules has also been demonstrated. Gold nanoparticles have been self-assembled at the surface of both amine- and thiol-functionalized boron nitride Nanotubes (BNNTs) in solution. This approach constitutes a basis for the preparation of highly functionalized BNNTs and for their utilization as nanoscale templates for assembly and integration with other nanoscale materials.
US08703022B2
The present disclosure provides an aqueous based electrically conductive ink, which is essentially solvent free and includes a nano-scale conducting material; a binding agent; and an enzyme. In one embodiment, the ink includes at least one of a mediator, a cross-linking agent and a substrate as well. In one further embodiment, the present disclosure provides electrically conductive ink including a single walled, carboxylic acid functionalized carbon nanotube; 1-Ethyl-3-[3-dimethylaminopropyl]carbodiimide hydrochloride and N-hydroxy succinimide (NHS) ester; polyethyleneimine; an aqueous buffer; and glucose oxidase.
US08703018B2
A compound is provided containing silicon, aluminum, strontium, europium, nitrogen, and oxygen is used that enables a red phosphor having strong luminous intensity and high luminance to be obtained, and that enables the color gamut of a white LED to be increased with the use of the red phosphor. The red phosphor contains an element A, europium, silicon, aluminum, oxygen, and nitrogen at the atom number ratio of the following formula: [A(m−x)Eux]Si9AlyOnN[12+y−2(n−m)/3]. The element A in the formula is at least one of magnesium, calcium, strontium, and barium, and m, x, y, and n in the formula satisfy the relations 3
US08702999B2
Method and plasma treatment apparatus for treatment of a substrate surface (1) using an atmospheric pressure plasma. An atmospheric pressure plasma is provided in a treatment space (5) between a first electrode (2) and a second electrode (3). Furthermore, a substrate (1) and a mask web (7) in contact with the substrate (1) are provided. A plasma generating power is applied to the first and second electrode (2, 3) for treatment of surface areas of the substrate (1) exposed by the mask web (7), in which the substrate (1) and mask web (7) are moved synchronously through the treatment space (5).
US08702998B1
A novel method to manufacture a flexible cable for a disk drive is disclosed. The method includes providing a flexible laminar sheet. The flexible laminar sheet has a dielectric substrate layer and an electrically conductive layer contacting a first side of the dielectric substrate layer. A portion of the electrically conductive layer is etched away to define a first plurality of electrically conductive traces and to expose an etched surface of the first side of the dielectric substrate layer. A second plurality of electrically conductive traces is deposited on the etched surface of the first side of the dielectric substrate layer.
US08702992B2
A continuous flow reactor, including a cylindrical coagulation crystallizer, a funnel type protective baffle for static settling, and a conical static settler. A lower end surface of the cylindrical coagulation crystallizer is connected with an upper end surface of the conical static settler, and the funnel type protective baffle for static settling is connected with an inner wall of the cylindrical coagulation crystallizer.
US08702991B2
Described herein are systems, methods, and apparatuses for aggregating microorganism in an aqueous suspension. In particular, are systems, methods, and apparatuses that apply an electrical field to an aqueous suspension comprising microorganisms as the aqueous suspension follows a flow path to cause aggregation of the microorganisms. The electrical field may be continuous or pulsed. In some embodiments, the flow path for the aqueous suspension may vary.
US08702986B2
A method for sulfurous acid leaching of heavy metals from soils into a contaminated water fraction for subsequent precipitation with alkaline and nutrient reagents for filtration removal to provide a metal free soil and reclaimed water suitable for raising crops and open stream discharge.
US08702985B2
The present invention relates to a dialysis machine having a coupling surface for the coupling of a fluid system, in particular for the coupling of a cassette, and having an actuator arranged on the coupling surface for the movement of an actuator region of the fluid system. In accordance with the invention, a heating element is now provided for the heating of the actuator, with the liquid being able to be heated via the actuator in the actuator region of the fluid system.
US08702971B2
One exemplary embodiment can be a process for alkylating and hydrogenating a light cycle oil. The process can include passing the light cycle oil, one or more C2-C6 alkenes, and hydrogen through a reaction vessel containing an alkylation zone and a hydrogenation zone. Generally, the hydrogen is at least partially comprised from a hydrocarbon product stream from a fluid catalytic cracking zone.
US08702969B2
A hydrocracking process that includes a wax fraction hydrocracking step of hydrocracking the wax fraction contained within a Fischer-Tropsch synthetic oil to obtain a hydrocracked product, a gas-liquid separation step of using a multi-stage gas-liquid separator to separate the hydrocracked product into a gas component, a heavy oil component and a light oil component, a specific component content estimation step of determining the flow rate ratio between the heavy oil component and the light oil component, and using this flow rate ratio to determine an estimated value for the content of a specific hydrocarbon component contained within the hydrocracked product, and a control step of controlling the operation of the wax fraction hydrocracking step on the basis of this estimated value, so that the content of the specific hydrocarbon component falls within a predetermined range.
US08702958B2
A method is provided for determining the presence or amount of an analyte in a sample and includes the steps of contacting a faradaic working electrode to a solution comprising the optionally pre-processed sample and an electrolyte, contacting a capacitive counter electrode to the solution, supplying electrical energy between the faradaic working electrode and the capacitive counter electrode sufficient to provide for faradaic charge transfer at the faradaic working electrode, and measuring at least one of (i) light, (ii) current, (iii) voltage, and (iv) charge to determine the presence or amount of the analyte in the sample.
US08702956B2
Some embodiments of the present invention provide processes and apparatus for electrochemically fabricating multilayer structures (e.g. mesoscale or microscale structures) with improved endpoint detection and parallelism maintenance for materials (e.g. layers) that are planarized during the electrochemical fabrication process. Some methods involve the use of a fixture during planarization that ensures that planarized planes of material are parallel to other deposited planes within a given tolerance. Some methods involve the use of an endpoint detection fixture that ensures precise heights of deposited materials relative to an initial surface of a substrate, relative to a first deposited layer, or relative to some other layer formed during the fabrication process. In some embodiments planarization may occur via lapping while other embodiments may use a diamond fly cutting machine.
US08702951B2
A electrophoresis device having glass gel cell fast assemble structure is provided, including a main body, a pair of electrode connection terminals attached to the main body, and side clamping parts pivotally connected to the main body on respective side of the main body for maintaining at least one glass gel cell to a surface of the main body. At least one sealing and positioning structure is provided on a surface of the main body including a U-shaped sealing strip partially inlayed on at least one surface of the main body, and at least a pair of positioning poles perpendicularly attached to the main body, wherein the U-shaped sealing strip having a U-shaped body to form a seal between the main body and the gel cell, and positioning protrusions formed on the respective free end of the U-shaped body.
US08702950B2
A device for electrophoresis applies a voltage to a medium in contact with a plurality of electric conductors so that a potential of adjacent conductors is within a certain range. This allows preventing decline in electrophoresis speed. A device for electrophoresis and transfer includes an electrode having a plurality of electrode regions being insulated one another and arranged in a specific direction. This allows providing a practical and easy-to-use device for electrophoresis and transfer. A device for transfer alters an applied voltage or applied voltage duration to a certain position to another position. This allows improving transfer efficiency.
US08702947B2
A device and a method for measuring microspheres are provided in which, in a microsphere measurement of a sample liquid in which blood or saliva exists mixedly with microorganisms (included in the definition of the microspheres in the application) that are the detection object, both a dielectrophoretic trap at a high solution electric conductivity, and a highly sensitive and accurate impedance measurement can be attained. The microsphere measuring device includes: a cell 1 into which a liquid containing microsphere is to be introduced; at least one pair of electrodes 11a, 11b which are immersed in the cell 1; a dielectrophoresis power supply unit 4 which applies an AC voltage of a high frequency in the vicinity of 1 MHz, between the pair of electrodes 11a, 11b, thereby causing a dielectrophoretic force to act on the microspheres; a measurement unit 5 which applies an AC voltage of a low frequency in the vicinity of 10 kHz, between the pair of electrodes 11a, 11b, and which measures the impedance between the pair of electrodes 11a, 11b; and a control calculation unit 6 which calculates a time change of the impedance between the pair of electrodes 11a, 11b, and which calculates the number of the microspheres in the cell 1.
US08702939B2
A method of controlling nematode response in a microfluidic environment is provided comprising exposing the nematode to an electric field that induces a nematode response. In one embodiment, a method of sorting a group of nematodes based on a selected parameter is provided comprising the step of exposing the nematodes to an electric field that induces a differential response among the nematodes based on the selected parameter, wherein the differential response functions to separate the nematodes based on the selected parameter. Devices useful to achieve these methods are also provided.
US08702938B2
The invention provides a droplet actuator comprising a base substrate and a top substrate separated to form a gap, wherein: (a) the base substrate comprises electrodes configured for conducting droplet operations in the gap; and (b) the top substrate comprises a first portion coupled to second portion, where the second portion comprises one or more openings establishing a fluid path extending from an exterior of the droplet actuator and into the gap. The invention also provides related methods of manufacturing the droplet actuator, methods of using the droplet actuator, and methods of loading the droplet actuator.
US08702936B2
A device for determining the CO concentration in a gas containing hydrogen is provided, including a detection electrode in contact with the gas, and a counter electrode, each being in contact with an electrolyte; a current source to deliver a current with a predetermined intensity between the detection electrode and the counter electrode so as to generate, at the detection electrode, an electric potential fluctuating between two threshold values due to the adsorption and desorption of the CO at the detection electrode; a device for measuring the potential; and a calculating device to determine the CO concentration, connected to the current source and to the device for measuring the potential, for calculating a characteristic parameter of the fluctuations of the potential, and for determining the CO concentration from the calculated characteristic parameter and the intensity of the applied current.
US08702933B2
A potentiometric sensor with suppressed leak current on the surface of an electrode and improved for a dynamic range and a response speed, in which a redox compound is immobilized through insulative molecules on the surface of a gold electrode, and a current between a source and drain of an insulated gate field-effect transistor along with reaction between an oxidized substance or a reduced substance produced by the reaction of a measured substance in a sample solution injector for supplying the sample solution containing the measured substance and an enzyme and a redox compound on the surface of the gold electrode, is monitored on real time to measure the change of the surface potential.
US08702930B2
A sensor chip is a sensor device for measuring a property of a substance by adsorbing the substance on a surface of the sensor chip. The sensor chip includes a diaphragm having a first surface, a second surface, and at least one through hole penetrating from the first surface to the second surface. At least a part of the first surface, the second surface, and an inner wall surface of the through hole is covered with a noncrystalline solid layer including SiOX as a main component, in which substance X is an element having higher electronegativity than that of silicon.
US08702922B2
The cell observation using a conventional well plate takes much costs. Each well 3 being opened at a top plate 2a of the well plate 1 has a diameter reduced portion 32 which inner circumferential surface 32a is conically hollowed. At a lower portion of the diameter reduced portion 32 is formed an inserting hole 33. In a detecting portion 4, an outer circumferential surface of a round-bar reference electrode 41 is covered by an insulating portion 42. The detecting portion 4 has an upper end portion 4a and a lower end portion 4b which outer circumferential surface is exposed to an outside without being covered by an insulating portion 42. On an upper side above the lower end portion 4b is formed a diameter expanded portion 4c in which an outer circumferential surface of the insulating portion 42 is covered with a measuring electrode 43. The detecting portion 4 is fixed to a well 3 whose diameter expanded portion 4c is inserted into an inserting hole 33 and its upper end portion 4a is contained in the well 3. In the detecting portion 4, the upper end surface 43a of the measuring electrode 43 is communicated with an inner circumferential surface 32a of the diameter reduced portion 32 positioned in an edge surrounding portion of the inserting hole 33.
US08702919B2
Sputtering targets are described that comprise: a) a target surface component comprising a target material; b) a core backing component having a coupling surface, a back surface and at least one open area, wherein the coupling surface is coupled to at least part of the target surface component; and wherein at least part of the target surface component fits into at least one open area of the core backing component. In some embodiments, the target surface component, the core backing component or a combination thereof have at least one surface area feature coupled to or located in the back surface of the core backing component, the target surface component or a combination thereof, wherein the surface area feature increases the cooling effectiveness of the target surface component. Methods of forming a sputtering target are also described that comprises: a) providing a target surface component comprising a surface material; b) providing a core backing component having a coupling surface, a back surface and at least one open area; c) coupling the coupling surface to at least part of the target surface component, wherein at least part of the target surface component fits into the at least one open area of the core backing component.
US08702918B2
In some embodiments, substrate processing apparatus may include a chamber body; a lid disposed atop the chamber body; a target assembly coupled to the lid, the target assembly including a target of material to be deposited on a substrate; an annular dark space shield having an inner wall disposed about an outer edge of the target; a seal ring disposed adjacent to an outer edge of the dark space shield; and a support member coupled to the lid proximate an outer end of the support member and extending radially inward such that the support member supports the seal ring and the annular dark space shield, wherein the support member provides sufficient compression when coupled to the lid such that a seal is formed between the support member and the seal ring and the seal ring and the target assembly.
US08702911B2
The present invention features a center feed system in combination with a coking vessel of a delayed coking system, or any other similar system. The center feed system features an inlet sleeve which slidably engages a retractable nozzle, with inlet and outlet, in fluid connection with a feed source of residual byproduct, allowing residual byproduct to flow from the feed source into the interior of the vessel, thus effectuating or inducing even thermal distribution throughout the vessel. The retractable nozzle is structured to extend through an opening in the coking vessel while introducing the residual byproduct into the coking vessel and retract out of the coking vessel and cover the opening for at least a portion of a coking cycle.
US08702908B1
Normalized values are determined from variance partition analysis data boxes acquired for a reel of paper. The value include an average value of variability of machine direction long-term scan energy over a time period; an average value of variability of cross direction profile scan energy observed in a spatial domain over a second time period; an average value of variability of energy of a remainder of data points that are averaged out from a total of machine direction long-term scan average energy variability and cross direction profile scan average energy variability during a third time period; and a total variability value as a function of the machine direction long-term scan average energy variability, the cross direction profile scan average energy variability and the data points remainder average energy variability. An automated diagnosis and analysis function is performed that is specific to one of the values exceeding a threshold.
US08702903B2
A thermally conductive sheet is used between a mounting table for mounting thereon a target substrate and an annular focus ring mounted on the mounting table to surround a circumferential peripheral portion of the target substrate. Further, the mounting table includes therein a cooling unit and is disposed in a depressurized accommodating chamber for accommodating therein the target substrate. The thermally conductive sheet has a non-adhesive layer on each of one or more surfaces thereof.
US08702899B2
Dryblend process for preparing high-reactivity polyurethane compositions containing uretdione groups
The present invention relates to polyurethane compositions containing uretdione groups that can be cured at a low temperature and are intended more particularly for polyurethane powder coating compositions and adhesive compositions, to a process for preparing them and to their use.
US08702898B2
A method for connecting a first joining partner to a second joining partner. After provision of the first joining partner and the second joining partner, a lacquer layer is applied to the first joining partner. Then the first joining partner and the second joining partner are saturated together with an impregnating resin. The lacquer layer is produced from a lacquer composition based on an epoxy resin mixture, a curing accelerator, a silane-based, epoxy-functional bonding agent, and a solvent. The epoxy resin mixture has 10 wt.-% to 94 wt.-% of at least one solid epoxy resin with a maximum epoxy count of 2 Eq/kg, 1 wt.-% to 50 wt.-% of at least one solid, multifunctional epoxy resin with an epoxy count >4 Eq/kg, and 5 wt.-% to 40 wt.-% of a phenol and/or kresol novolak with a melting point >30° C. After impregnation, the viscosity of the impregnating resin is reduced such that the first joining partner and the second joining partner are connected to one another.
US08702896B2
A heat-sensitive adhesive material contains a substrate and a heat-sensitive adhesive layer that contains a thermoplastic resin and a solid plasticizer, and the heat-sensitive adhesive material is so configured as to be heated and applied to an adherend, wherein the heat-sensitive adhesive material exhibits such an adhesive strength to the adherend as to increase with time from immediately after applying the heat-sensitive adhesive material to the adherend.
US08702895B2
A method for manufacturing the cushioning elements may include utilizing a die with a plurality of die elements positioned in a particular arrangement. A polymer material, which may be a polymer foam material, is located between the die and an extractor. The polymer material is compressed between the die and the extractor, and the die elements cut the polymer material to form a plurality of pad components, which are arranged like the die elements. The die and the extractor are separated, and the pad components are secured to the extractor in the arrangement of the die elements. Additionally, the pad components are bonded to at least one material layer such that the pad components remain in the arrangement of the die elements.
US08702893B2
A machine that processes gift cards in an in-line process where the gift cards travel along a generally straight transport path from a card feed mechanism to a delivery end where the cards and carrier combinations are discharged. During the in-line processing, a magnetic stripe, integrated circuit chip or RFIID tag on the gift cards can be encoded with account information, a serial number or other information. In addition, the cards are transported to a print mechanism that personalizes the cards with a bar code. account information, serial number or other information. After printing, the cards are transported to a gluing system which applies adhesive to one side of the cards. The cards arc then transported to a feeding mechanism that feeds and applies a carrier to one or more cards.
US08702889B2
An adhesive material and articles incorporating the same is disclosed. The adhesive material includes at least three of epoxy resin; impact modifier; flexibilizer, blowing agent; curing agent; and filler. The adhesive material is preferably used for structural adhesion but may be used for sealing, baffling or reinforcing an article of manufacture such as an automotive vehicle.
US08702874B2
Embodiments of the present invention are related to a method and an associated system for removing a forming or fully developed clog from a drain hose in a dishwasher. According to one embodiment, the system includes a drain pump configured to remove water from the dishwasher and a drain hose in fluid communication with the drain pump. The system further includes a control device in operable communication with the drain pump and configured to execute a drain routine in response to detecting a clog in the drain hose, wherein the drain routine comprises repeatedly activating and deactivating the drain pump to facilitate removal of the clog.
US08702862B2
The present invention relates to a universal metallic/pearlescent colorant composition that is free of VOCs including alkylphenol ethoxylate (APE) and formaldehyde. The colorant composition comprises substantially no resin and comprises microcrystalline cellulose and optionally a synthetic silicate to disperse the metallic pigments.
US08702859B2
Provided are polyhydroxy-diamine compounds of the formula I: or salt thereof, wherein R1, R2, and R3 are as defined herein. The compounds are useful as low additives for paints, coatings and epoxy formulations.
US08702846B2
A process is disclosed for removing acid gases from a gas stream, in particular from a natural gas stream, synthesis gas stream or the like, wherein the acid gases are absorbed from the gas stream by at least one absorbent. The absorbent used is a mixture of a physical scrubbing agent, a chemical scrubbing agent and water. The absorbent comprises more than 60% by weight of the physical scrubbing medium, wherein the physical scrubbing medium used is a morpholine derivative and a chemical scrubbing agent based on at least one aliphatic amine compound which includes a polyethylene glycol substituted amine.
US08702841B2
A portable oxygen concentrator designed for medical use where the usable life of the sieve beds, adsorbers, is monitored and communicated to the user or service provider through a user interface or a transmitted signal. The concentrator is designed so that the beds are easily replaced by the user or a field technician. Preferably PSA cycle operating parameters appropriate to the replaced beds can be easily reset if needed by the user or service provider.
US08702830B2
A filtering apparatus having a plurality of passages made up of juxtaposed longitudinally extending channels. The passages are axially divided by a porous filtering media extending across the channels whereby the channels fluidly communicate through the porous filtering media. A pressure differential is created across the filtering media by restricting flow through an end of each channel, with each restriction being at an opposite end from that of the other channel. As flow restriction rather than outright blocking is used, some flow is possible along each passage directly along the channels even if the channels lose the ability to fluidly communicate through clogging of the filtering media.
US08702826B2
A method for producing abrasive agents includes: adding a silica to a manganese compound; heat-treating the manganese compound to which the silica has been added; forming abrasive grains by milling the manganese compound to which the silica has been added and which has been heat-treated; and adding a solvent to the abrasive grains.
US08702825B2
A method of forming a cutting element that includes filling at least one non-planar region on an upper surface of a carbide substrate with a diamond mixture, subjecting the substrate and the diamond mixture to high pressure high temperature sintering conditions to form a reduced-CTE substrate having polycrystalline diamond that extends a depth into the reduced-CTE substrate in an interface region, and an upper surface made of a composite surface of diamond and carbide, and attaching a polycrystalline diamond body to the composite surface of the reduced-CTE substrate is disclosed.
US08702813B2
The invention relates to the use of specific ascorbic acid derivatives for dyeing keratin-containing fibers or as direct dyes for the preparation of a composition for dyeing keratin-containing fibers, and to methods for dyeing keratin-containing fibers, in particular for dyeing human hair.
US08702812B2
Methods and arrangements for ensuring that, when a computer system is stolen or otherwise misplaced, the system is rendered unusable (i.e., locked down). Conventional solutions have required software running on the system to perform the lockdown action, but in accordance with at least one preferred embodiment of the present invention is the linkage of TPM (Trusted Platform Module) and AMT (Active Management Technology) solutions whereby an AMT arrangement can remove secure data or identifiers so that any encrypted data present on the system will become unusable.
US08702776B2
A sleeve device, system and method are provided for restricting and/or constricting aneurysms. More particularly, a sleeve and/or a double-walled sleeve is located in or on a vessel in the location of an aneurysm. When placed around the outside of a vessel, is used to restrict and/or constrict the aneurysm containing portion of the vessel. If desired, the sleeve may be constructed as a double-walled sleeve that can be inflated to apply pressure to and/or in the vessel.
US08702774B2
Devices, systems and methods for removing heat from subcutaneously disposed lipid-rich cells are disclosed. In selected embodiments, suction and/or heat removal sources are coupled to an applicator. The applicator includes a flexible portion and a rigid portion. The rigid portion includes a thermally conductive plate and a frame coupling the thermally conductive plate and the flexible portion. An interior cavity of the applicator is in fluid communication with the suction source, and the frame maintains contiguous engagement between the heat removal source and the thermally conductive plate.
US08702769B2
A technique for detecting and providing alerts or indications that can be used for controlling or altering the displacement speed of an applicator coupling skin heating energy across a treated skin. A temperature sensor monitors the rate of skin temperature change and provides feedback related to altering the applicator displacement speed according to the rate of skin temperature change. Disclosed is also an applicator for implementing this method.
US08702761B1
A limited angulation bone screw assembly adapted to couple a spinal rod with a vertebra including a bone screw, a bushing and a housing. The pedicle screw having a shaft and an upper head portion, the upper head portion comprising a spherical surface with flats disposed on opposite sides of the upper head portion. The bushing comprising a lower rounded surface for mating with the spherical surface and flats of the upper head portion to restrict the angular movement of the bone screw. The coupled bone screw and bushing are inserted into the housing in a first orientation and then rotated to a second orientation to secure the coupled bone screw and bushing to complete the housing.
US08702754B2
Methods and devices are provided for anchoring suture to bone. In one exemplary embodiment, a cannulated suture anchor is provided and it includes a suture-engaging member formed therein and configured to receive a suture therearound such that trailing ends of the suture can extend through the suture anchor. The suture anchor can also include at least a proximal portion having dual threads to facilitate engagement with bone. The present invention also provides exemplary sutures and drivers that can be used with the various methods and devices disclosed herein, or with other methods and devices known in the art.
US08702752B2
Knotless fixation of soft tissue to bone is accomplished using a bone anchor configured to provide interference fixation of a soft-tissue connector. The soft-tissue connector is provided in the form of a flat narrow piece of material. Additional fixation strength can be provided by configuring the bone anchor to penetrate into or through the soft-tissue connector. The bone anchor is installed into a pre-formed hole or socket in the bone.
US08702744B2
The present invention provides and apparatus and methods for emboli removal and stenting within the renal arteries having a catheter system having a distal occlusion element, a stent deployment section, and an emboli removal lumen. The occlusion element is disposed at a predetermined distance from the stent deployment section specific for use in the renal artery, and is constructed to reduce the potential for perforation or jailing during stent deployment. The apparatus further includes an array of radio-opaque markers disposed on the stent delivery catheter to facilitate accurate stent deployment within a renal artery.
US08702741B2
In a device for injecting bone cement, the discharge direction of the bone cement after insertion of the cannula should be controllable in a certain region. This is made possible through a radial exit aperture (5) which is provided on the front end of the cannula (3). Since the cannula is inserted with the aid of a guide wire (1), it has an orifice (4) on its front end, which orifice must be closed off by means of a ball (15) prior to the injection. A plunger serves to insert the ball (15). So that the situation of the radial aperture (5) is known at all times, even with inserted cannula, the handle (17) of the cannula has an asymmetrical shape.
US08702738B2
A tissue cutting device that is especially suited for neurosurgical applications is disclosed and described. The device includes a handpiece and an outer cannula in which a reciprocating inner cannula is disposed. The inner cannula includes a hinge between a body section and a cutting section that allows the cutting section to pivot when the inner cannula reciprocates within the outer cannula. A tissue collector is also provided and is in fluid communication with the lumen of the inner cannula. The handpiece includes a proximal section that is angled with respect to a distal section.
US08702736B2
A method of treating a lesion in a body lumen to enlarge a passageway in the lumen including providing a cutting member, connecting a tracking member to the cutting member to form an assembly, inserting the connected cutting member and tracking member through a first lumen of a catheter, withdrawing the catheter from the cutting member and tracking member, inserting the catheter over the tracking member and leaving the cutting member outside the catheter, and expanding a portion of the catheter to move the cutting member into cutting contact with the lesion. A device for treating a lesion in a body lumen including a cutting member having a coupler to connect a tracking member is also provided.
US08702735B2
The invention provides a rotational atherectomy device having, in various embodiments, a flexible, elongated, rotatable drive shaft with at least one asymmetric and at least partially spherical abrading element attached thereto, which comprises an abrasive surface. The abrading element comprises more mass above the drive shaft than below and comprises a flattened side or transverse surface which creates hard cutting edges and spaces the center of mass radially from the rotational axis of the drive shaft. Thus the center of mass is moved vertically and transversely by the structure of the abrading element, conferring geometric and mass eccentricity upon the element. When placed against stenotic tissue and rotated at high speed, the eccentric nature of the abrading element moves along an orbital path, opening the lesion to a diameter larger than the resting diameter of the abrading element.
US08702729B2
A suturing instrument for placing multiple sutures include an elongate body engaged to a handle. A suturing head extends from a distal end of the elongate body, and the suturing head is articulable relative to the elongate body. Both a first needle carrier and a second needle carrier are movable into and out of the suturing head. A first actuator allows controlled movement of the first needle carrier, and this first actuator extends from a proximal end of the handle. A second actuator allows controlled movement of the second needle carrier, and this second actuator also extends from the proximal end of the handle. The suturing head can be articulated within a range of about 0 degrees to about 30 degrees, as measured from a longitudinal axis running along the length of the elongate body, and this variable articulation angle of the head allows deployment of the first needle carrier and the second needle carrier at various orientations with respect to the longitudinal axis.
US08702724B2
A thrombus retrieval device has one or more thrombus engaging elements that are movable between a retracted configuration in which they are stowed within the device and a deployed configuration in which they project from the device to snare an adjacent thrombus for removal from a blood vessel.
US08702721B2
An apparatus for moving an object disposed within a body lumen. The apparatus includes a first sheath, a coupling member and at least one contraction member for engaging at least a portion of the object. The coupling member is movable relative to the first sheath between a retracted position and a capture position. In the retracted position, a distal portion of the coupling member is disposed within the first sheath. In the capture position, the coupling member distal portion is disposed outside the first sheath. The coupling member is also selectively attachable to the object in at least the capture position. When the coupling member is attached to the object and the contraction member is directly engaged with the object, a predetermined coupling member movement relative to the contraction member radially contracts at least a portion of the object thereby facilitating movement of the object within the body lumen.
US08702717B2
An orthopaedic alignment guide component is provided for preparing a patient's bone socket, such as the glenoid of the patient's scapula, to receive a prosthetic glenoid component. The orthopaedic alignment guide component includes a guide body for inserting a guide pin into the patient's scapula and an inferior referencing arm for referencing an inferior surface of the patient's scapula.
US08702703B2
Device and method for sub-xiphoid ablation of patient tissue. A sub-xiphoid access clamp has a handle, an elongate neck coupled to the handle and first and second opposing jaws. The first and second opposing jaws have first and second opposing relief segments being generally co-planar and concave with respect to one another to form a void therebetween, and first and second opposing elongate ablation elements positioned along the first and second opposing jaws and distal of the first and second opposing relief segments relative to the handle. The first and second opposing jaws are articulate between a closed position and an open position to admit, at least in part, a second portion of tissue of the patient within the void created by the first and second opposing relief segments while the first portion of tissue is positioned between the first and second ablation elements in the closed position.
US08702685B2
Drug delivery systems, apparatus and methods to treat erectile dysfunction via an implanted drug infusion pump. The drug delivery system incorporates a passively pressurized drug infusion pump, one or more catheters, one or more microfluidic valves, a microcontroller, and one or more patient input mechanisms to deliver therapeutic solutions to the erectile tissues of a patient. The system in operation is entirely implanted and provides for moderated patient control over dosage via subcutaneously implanted input mechanisms, including in certain embodiments, neural control.
US08702684B2
A device (10) for receiving implanted biological material includes a mechanoprotective surface (16) defining an adjacent space, an assembly (26, 28) for locally delivering media to said space, and a pump or slow/sustained release reservoir structure (14) operatively coupled to the assembly. The device may comprise an additional plunger body for being disposed in said space. The implanted biological material may be encapsulated or non-encapsulated.
US08702675B2
A vial adapter is provided with a fitting portion which can be fitted into the head portion of a vial, and a hollow needle with a side hole. The base end portion of the needle is provided with a stopper contact portion which contacts the top surface of a stopper when the fitting portion is fitted in the head portion of the vial. When the fitting portion is fitted in the head portion of the vial, the stopper contact portion contacts the top surface of the stopper, and the fitting portion is fixed to the head portion of the vial by a claw engaging with the head portion of the vial, and further, the region of the side hole nearest the base end portion of the needle is positioned either roughly at the bottom surface of the stopper or inside of the stopper.
US08702671B2
A disposable absorbent article has a central body defining a first waist end region including a first end edge, a second waist end region spaced longitudinally from the first waist end region and including a second end edge, and a crotch region positioned therebetween. An absorbent core is situated between the end edges, and includes a plurality of elastics incorporated therewith such that the core is substantially laterally contracted in a narrowed region about the elastics. The absorbent core includes at least one end region that is substantially non-elasticized and has a lateral width substantially wider than that of the narrowed region.
US08702669B2
A diaper sheath having a shell with an inner panel and an outer panel forming a front edge, a back edge, a first side edge and a second side edge. The diaper sheath also includes a first intermediate pocket and a second intermediate pocket set along the first side edge and the second side edge respectively, each intermediate pocket having at least one opening. The diaper sheath further includes a first intermediate strip and a second intermediate strip set inside each of the first and second intermediate pockets respectively, the first and second intermediate strips each having an anchor portion attached to an attachment ring, and an elongated portion having a loop formed through a slide, the loop passing through the attachment ring and having a continuously adjustable length selected by moving the slide to a desired position along the elongated portion.
US08702660B2
A device for delivering medicament includes a guide nut with guide ledges which cooperate with longitudinal grooves of a plunger rod for providing a rotational lock but allowing longitudinal movement of the plunger rod in relation to the guide nut that is rotationally locked to a distal housing part by engagement devices when the distal housing part and a proximal housing part are connected to each other. The device further includes a pressure release mechanism that includes slanting wedge-like surfaces arranged on the drive nut and slanting wedge-like surfaces arranged on a fixed inner annular surface of the distal housing part, which slanting wedge-like surfaces abut each other such that they move out of contact near the end of delivery of a predetermined quantity of medicament when the drive nut is rotated.
US08702651B2
A balloon carries a drug in drug-carrying regions, wherein the drug-carrying regions protect the drug during delivery through a patient's vasculature. Once at a target site, the balloon expands, causing the drug-carrying regions to expose the drug to the target site. One drug eluting balloon device includes a longitudinal sheath that defines an interior space having a balloon disposed therein. When the balloon expands, at least one push element at least partially inverts at least one pocket formed on an outer surface of the sheath. This inversion causes a drug contained within the at least one pocket to be released to the target site. In another embodiment, a plurality of bands is provided, each band made of material having a different resistance to elongation. Upon expansion, the bands invert to expose a drug provided on a surface of the bands.
US08702628B2
A physiological sound examination device includes a physiological sound measurement unit; a power calculation unit which calculates power of a first physiological sound and power of a second physiological sound, the first physiological sound being one of two different kinds of physiological sounds measured by the physiological sound measurement unit in a same time period and the second physiological sound being the other of the two different kinds of physiological sounds; a power comparison unit which compares first power indicating the power of the first physiological sound and second power indicating the power of the second physiological sound, to calculate a comparison result indicating a ratio or a difference between the first power and the second power; and a determination unit which determines whether or not a measurement position of the physiological sound is appropriate, by comparing the comparison result with a threshold.
US08702627B2
According to certain described aspects, multiple acoustic sensing elements are employed in a variety of beneficial ways to provide improved physiological monitoring, among other advantages. In various embodiments, sensing elements can be advantageously employed in a single sensor package, in multiple sensor packages, and at a variety of other strategic locations in the monitoring environment. According to other aspects, to compensate for skin elasticity and attachment variability, an acoustic sensor support is provided that includes one or more pressure equalization pathways. The pathways can provide an air-flow channel from the cavity defined by the sensing elements and frame to the ambient air pressure.
US08702625B2
A steerable wire-guide comprises an elongate member having a longitudinal axis. The elongate member comprises a leading portion and a body portion. The leading portion comprises a loop and the body portion comprises a first wire and a second wire. The first and second wires are movable relative to each other such that relative movement of the first wire with respect to the second wire directs the leading portion in a first direction, which is at an angle relative to the longitudinal axis, and relative movement of the second wire with respect to the first wire directs the leading portion in a second direction different from the first direction.
US08702622B2
A method for extracting a tissue sample includes altering the pressure inside the lumen of a cannula to facilitate extraction of a tissue sample from the cannula. One aspect of the invention includes a biopsy apparatus comprising a valve for controlling the pressure inside the lumen of the cannula. In one variation, the pressure/vacuum generating device is connected to a cannula with a closed distal end and an orifice located on a circumferential surface of said cannula. A cutting sheath is slidably disposed over said cannula. The valve may be provided between the pressure/vacuum generating device and the cannula to control the pressure within the lumen of the cannula.
US08702620B2
The present invention relates to a monitoring system and method for use with a body of a subject. The system comprises a medical device, having a portion thereof configured to be placed inside the subject's body, said portion of the medical device being configured to be propelled by fluid pressure through a body lumen; at least two pressure sensors accommodated remotely from the subject's body at two different spaced-apart positions outside the subject's body and configured and operable to detect pressure at the two spaced-apart remote positions; said at least two pressure sensors being in fluid communication with at least one site inside the subject's body, a relation between the pressure at said at least one site and the pressures at said two spaced-apart remote positions being thereby indicative of the fluid pressure at said at least one site.
US08702611B2
The ultrasound probe includes a first priority setting unit which sets a priority regarding which of temporal resolution and spatial resolution is given preference, and a measurement parameter setting unit which sets values of measurement parameters relating to the temporal resolution and the spatial resolution in accordance with the priority set by the first priority setting unit and a measurement depth set in advance such that power consumption falls within the allowable power consumption.
US08702610B2
A diagnostic ultrasound image of a region of interest (ROI) of a body is formed by transmitting into the ROI at least a first and a second ultrasound pulse, in which the second pulse is phase-shifted relative to the first pulse by an amount other than 0 or 180 degrees. Discretized receive signals from the pulses are interleaved to form a resultant operating signal that is detected and beamformed as the operating signal.
US08702607B2
Systems and methods for monitoring various physiological and environmental factors, as well as systems and methods for using this information for a plurality of useful purposes, are provided. Real-time, noninvasive health and environmental monitors include a plurality of compact sensors integrated within small, low-profile devices. Physiological and environmental data is collected and wirelessly transmitted into a wireless network, where the data is stored and/or processed. This information is then used to support a variety of useful methods, such as clinical trials, marketing studies, biofeedback, entertainment, and others.
US08702603B2
A system and method for providing baseline data for automated patient management is disclosed. A patient is identified for enrollment in automated patient management with information including at least one of treatment profile and medical history. Device measures are collected to provide raw physiometry for the patient regularly recorded by a medical device, beginning with an initial observation period. Derived device measures are determined to provide derivative physiometry based on the collected device measures. Baseline data from the collected and derived device measures are quantified.
US08702597B2
A system, method and device for immobilizing an imager in-vivo and/or focusing images on the imager reflected from an in-vivo site to be monitored with for example a moveable or otherwise adjustable focusing mechanism. The imaging sensor may for example be positioned on an acute angle to an in-vivo surface to which the device is immobilized so that the device may for example image an in-vivo area that is opposed to such device. Sensors in addition to or other than an imaging sensor may be used.
US08702594B2
An imaging system can include a base unit and one or more imaging units. The base unit can include a main interface that has a plurality of main electrical connectors and one or more main mechanical connectors. A mechanical system is located in the base unit. Each imaging unit can include an elongate support member having a proximal end, a proximal section, a bendable section, and a distal end. Also, an imaging interface that couples with the main interface can be included on the proximal end of the elongate support member. The imaging interface includes a plurality of imaging electrical connectors that correspond and connect with the main electrical connectors of the main interface and includes one or more imaging mechanical connectors that correspond and connect with main mechanical connectors of the main interface. Mechanical actuators can bend the bendable section under control from the base unit.
US08702592B2
This group of inventions provides means and methods for preventing the damaging portions of surgical tools, such as laparoscopic devices, from adversely contacting tissues and organs that are not in the desired field of surgery. As such, the present disclosure pertains to any form of a warning or positioning device or methods, including those that are facilitated via software that are adapted and arranged for use in tracking portions of surgical instruments during laparoscopic surgery or other medical procedures. Such systems include those that are adapted and arranged to provide a warning to the surgeon or other medical personnel regarding the positional status of an instrument, and those that are adapted and arranged for disabling or attenuating the portions of those instruments that might be dangerous to a patient when a dangerous portion of the instrument is near or outside the desired, or denominated, field of surgery. Data relating to the position and orientation of the instrument and of the position of a safe zone within which the instrument can be kept safely is optionally (preferably) stored throughout a medical procedure for later playback for training purposes or for ensuring that a patient was not injured during a medical procedure.
US08702590B2
The present invention discloses a system for handling a surgical instrument, useful for observation and/or intervention with respect to a patient's body. The system comprising a fixed support; hinge which enable changing of the inclination of the system; actuators system that produce the rotation movement utilized by handling surgical instrument mechanism; a flexible power transmission system; gear housing adapted to change the direction of the motors rotation transmitted by the flexible power transmission system; and, handling surgical instrument mechanism, said mechanism comprising: a first small size moveable element, connected to the gear housing is adapted to simultaneous maneuver of a second moveable element to the four main directions, and/or any other maneuver, e.g., right and left, forward and backward; and, a second moveable element that which is adapted to move the surgical instrument to another directions, zoom in and zoom out, simultaneously rotate the surgical instrument, either clockwise or counter-clockwise, simultaneously rotate the camera housing in respect to the surgical instrument clockwise and counter-clockwise.
US08702586B2
An implantable article and method are disclosed for treating pelvic floor disorders such as vaginal vault prolapse. A surgical kit useful for performing a surgical procedure such as a sacral colpopexy is also described.
US08702582B2
The invention involves enhancing brain function by stimulating the brain using magnetic fields. Applications of the new methods include improving the condition of individuals with cognitive disorders, such as depression, and studying the effects of neural stimulation using induced electric fields. These techniques can avoid deleterious effects of psychotropic pharmaceutical treatments, and provide a relatively safe, comfortable, inexpensive means of direct cranial stimulation.
US08702573B2
A glute exercise machine has a stationary main frame, a pivotally mounted upper torso support, a knee support, and an exercise arm having a foot support for engaging a user's foot and configured for rotation from a start position by user engaging the knee support with one leg and the exercise arm with the other leg. A connecting linkage translates movement of the exercise arms into rocking movement of the upper torso support. A load is linked to one of the moving parts to provide exercise resistance.
US08702555B1
A transmission is provided having an input member, an output member, a plurality of planetary gear sets, a plurality of coupling members and a plurality of torque transmitting devices. One of the plurality of torque transmitting devices is an integrated friction launch clutch. A one-way clutch is in series relationship with the launch clutch and is configured to disconnect the launch clutch from at least one of the plurality of planetary gear sets. The torque transmitting devices include clutches and brakes actuatable in combinations of two to establish at least ten forward gear ratios and one reverse gear ratio.
US08702553B2
An assembly includes first and second components, a shaft supported on the components, a gear wheel transmitting torque between a transmission output and a differential mechanism, and a bearing supporting the gear wheel on the shaft, transmitting axial force in a first direction between the gear wheel and the first component, and axial force in a second axial direction opposite the first direction between the gear wheel and the second component.
US08702551B2
A wobble mechanism, in particular for a two-part adjustment fitting of a vehicle seat, is provided with a flat housing with internal toothing and with an oscillating wheel with external toothing, which is arranged within the housing and is eccentrically rotatable around a center axis of the housing. The external toothing of the oscillating wheel engages with the internal toothing of the housing. The housing is divided into at least two housing parts along a dividing plane.
US08702541B2
An apparatus for the game of baseball for the blind comprises a base for the game of baseball for the blind comprising: sound reproduction means; and a control and operating unit, connected to the sound reproduction means for activating a reproduction of a sound depending on a control signal, the apparatus further comprising a control device, equipped with a control push-button, operatively connected to the control and operating unit for allowing a user to transmit the control signal to the control and operating unit.
US08702539B2
A push-pass technique system and method in accordance with the present invention for training soccer players having a frame along which is a track, that is formed into a semi-circle, raised on each end by graduating ramp, upon which slides a foot pedal that can be secured by four wheels on each side to the track and the frame. The foot pedal glides back and forth upon the horizontal plane and moves length-wise across the plane to a pre-determined length following the curvature of the ramp. The foot pedal will guide the player's foot into the proper horizontal position while training the player to execute the proper push-pass soccer technique and gain muscle memory.
US08702534B2
A golf club (40) having a club head (42) with a face component (60), an aft body (61), and a sound modifying sole and crown design is disclosed herein. The face component, which may be composed of a metal material, (60) has a striking area portion (72) and a return portion (74). The aft-body (61), which may be composed of a non-metal material such as composite or thermoplastic material, is composed of a crown portion (62) and a sole portion (64). The sound modifying design, which may include deep pockets or pillars extending from the sole portion (64) to the crown portion (62), alters the sound of the golf club head (42) when it impacts a golf ball.
US08702532B2
A golf club head is provided having a body and a face insert, with a slot in a perimeter region of the body of the club head adjacent the face insert. The slot increases the flex of the hitting surface on impact with a golf ball, thereby increasing the speed with which the ball rebounds off the hitting face and increases the overall distance the ball is hit. The slot preferably moves the sweet spot of the hitting face a distance X from the face center of the hitting face. The slot may be filled with an elastomeric material.
US08702526B2
A convertible support apparatus and related methods are disclosed. An example convertible support apparatus for supporting a seat in a first mode and a second mode includes a substantially flexible section to support the seat in a first mode, and a substantially rigid bypass. The substantially rigid bypass is positioned to selectively deactivate the substantially flexible section when the convertible support is in the second mode.
US08702515B2
A multi-platform gaming system for amusing or entertaining one or more game participants playing a game on a gaming platform is described. The multi-platform gaming system can include collectible toys depicting or representing one or more game characters or objects relevant to a game adapted to be played on the gaming platform. The collectible toys can have associated therewith an RFID tag including a corresponding unique tag identification number. The RFID tag can include an antenna, integrated circuitry for wirelessly transmitting and receiving information to and from an associated RFID tag reader, and non-volatile programmable memory for storing game-relevant information describing skills, abilities or attributes associated with one of said game characters or objects.
US08702508B2
A community game that adapts a scene on a community display based on the number of participating players and/or player locations from one session of the community game to another or in any given session and/or number of the gaming terminals. Selectable elements are displayed on the community display for selection by the participating players. When additional players are eligible to participate in the community game, a field of view or a virtual camera angle of a scene is changed to reveal additional selectable elements or a greater variety of selectable elements than were available for selection with fewer participating players. Any of the selectable elements can be cooperatively selectable elements which multiple players can select to reveal an enhanced award. Based on the players' locations, the scene can be adapted to portray selectable elements or previously hidden or obscured areas of the scene closest to the newly participating player(s).
US08702502B2
Methods and apparatus for authenticating content in wagering game machines are described herein. In one embodiment, the computer-implemented method includes authenticating a first set of wagering game files stored on a storage device of a wagering game machine. The method can also include starting a wagering game on the wagering game machine if the authentication of the first set of wagering game files is successful. The method can also include authenticating, during the wagering game, a second set of wagering game files stored on the storage device of the wagering game machine, wherein the first set of wagering game files and the second set of wagering game files are mutually exclusive. The method can also include stopping the wagering game if the authentication of the second set of wagering game files is not successful.
US08702501B2
Techniques for forming and using formal partnerships are disclosed. Two or more entities (e.g., individual players, groups, organizations) can form a partnership for the purpose of participating in one or more games. In effect, a game can be played for a partnership without the active participation of all the entities (or partners) that have formed the partnership. The game can, for example, be played by one or the partners or an authorized representative of the partnership. When a game is played on behalf of a partnership, the gaming activity is effectively tracked and verification data is stored for the partnership. Verification data can be made available to allow the partners to verify the outcome of the game.
US08702494B2
A gaming machine comprising a game controller that enhances a prize won from a game outcome when a first special symbol occurs in the game outcome. The appearance of the first special symbol in the game outcome causes the game controller to further enhance the game prize if a second special symbol also appears in the game outcome. The first or second special symbols may further be used to substitute for another symbol in the game outcome, so as to create a winning game outcome.
US08702485B2
Presented herein are methods, apparatuses, programs, and systems for scoring a player performance comprising one or more poses in a dance-based video game. a performance 3D skeleton is received that indicates a pose of the player. A score is calculated by comparing a position, a timing, or both, associated with one or more joints of the performance 3D skeleton to a position, a timing, or both, associated with one or more joints of a target pose and altering one or more characteristics of the dance-based video game based on the score.
US08702484B2
An automatic corn cutting apparatus for cutting kernels off of husked ears of corn. The ears may be presented to the cutting knives either tip end or butt end first. The ears are fed into the cutting knives by a pair of drive rollers carried by a pair of articulating drive shafts. The drive shafts move in a plane perpendicular to the axis along which the ears are fed to the cutting knives. A sensor, preferably a linear variable differential transformer, or LVDT, is carried by one of the drive shafts remotely from the ears, i.e. the LVDT does not contact the ears. The sensor detects the profile of each ear of corn, and the profile is used by a knife controller to efficiently remove the kernels from each ear of corn.
US08702480B1
A poultry wing segmenting shackle and method of use having bifurcated support device, preferably configured as guide fingers to form bifurcated opening having an open end gripper to support the poultry wing therein and wherein bifurcated support device includes leading prong and trailing prong whereby leading prong longer in length (or extends beyond) trailing prong, and, thus, functions to improve the release of poultry wing therefrom poultry wing shackle.
US08702476B2
A machine for centrifugally shooting abrasives that shoots the abrasives by rotation of an impeller is provided. In the machine, the impeller comprises a pair of disc-shaped side plates that face each other at a predetermined distance and a plurality of blades disposed between the side plates in the radial direction of the side plates. The impeller is mounted on a hub that is fitted into an output shaft of an electric motor. The impeller is covered by a cover. The side liner and blades of the machine can be easily replaced. A side liner 3 that is U-shaped with the longer side facing downward is detachably attached to the inner side of the cover 2. The upper part of the side liner is divisible into two parts. The side liner protects the side wall of the cover 2 from the abrasives that are shot from the impeller. The side liner has a U-shaped cross section. The impeller 1 is fixed to the hub 4 by screwing a bolt 15 on the hub 4 from the inner sides of the side plates 11. The diameter of the impeller 1 is limited to be 200 mm at maximum.
US08702475B2
Grinding machine for grinding workpieces, in particular cams, a grinding machine holder and a method for grinding cam sets using such a grinding machine. Grinding machine comprising a machine bed, at least one grinding spindle, two grinding wheel holders, on which in each case at least one grinding wheel is arranged and which are arranged in opposite directions to one another in their orientation and are oriented parallel to one another with their longitudinal axes, and two workholding devices which in each case have a work headstock and a steady rest and which are arranged in opposite directions to one another in their orientation and are oriented parallel to one another with their longitudinal axes, wherein each work headstock and the associated steady rest are designed for the arrangement therebetween of a separate work fixture having workpieces to be ground.
US08702473B1
A polishing system for polishing a flat face of a rock comprises a polishing surface, a fence system, and a drive system. The polishing surface is supported for rotation about a primary rotation axis. The fence system is supported above the polishing surface. The drive system causes the polishing surface to rotate about the primary rotation axis and displace a driven portion of the fence system along a path relative to the primary rotation axis. The fence system engages the rock to prevent the polishing surface from causing the rock to move about the primary rotation axis and to cause the rock to move towards and away from the primary rotation axis.
US08702472B2
A polishing composition contains at least abrasive grains and water and is used in polishing an object to be polished. The abrasive grains are selected so as to satisfy the relationship X1×Y1≦0 and the relationship X2×Y2>0, where X1 [mV] represents the zeta potential of the abrasive grains measured during polishing of the object by using the polishing composition, Y1 [mV] represents the zeta potential of the object measured during polishing of the object by using the polishing composition, X2 [mV] represents the zeta potential of the abrasive grains measured during washing of the object after polishing, and Y2 [mV] represents the zeta potential of the object measured during washing of the object after polishing. The abrasive grains are preferably of silicon oxide, aluminum oxide, cerium oxide, zirconium oxide, silicon carbide, or diamond. The object is preferably of a nickel-containing alloy, silicon oxide, or aluminum oxide.
US08702471B2
Post-operative medical prosthetic devices, more particularly a combined garment and prosthesis that is useful for female patients having major chest trauma, including post-op mastectomy, burn, heart and lung surgery, and for patients having severe chest skin sensitivity, including skin and sub-dermal post-op surgical exposed tissue, healing scars, gangrenosis, chemotherapy and the like. The inventive garment/prosthesis includes an undergarment comprising a uniquely designed upper-half-bra having a special pocket for an insertable/removable upper-half-breast prosthesis that only contacts the upper portion of the chest, well above areas of surgical trauma. This provides a cantilever, permitting over-garments to drape free from contact with the chest and stomach exterior surfaces. In a second embodiment, the inventive garment/prosthesis is integrated with an over-garment, including by way of example: fashionable dresses, blouses, camisoles, tailored shirts, gowns, loungewear, sleepwear, sportswear, caftans, formal attire, career wear, and the like.
US08702469B2
A moisture management fabric using denier differential to facilitate the movement of sweat away from the wearer's body is presented. An exemplary moisture management support garment constructed from an exemplary moisture management fabric is presented. An exemplary moisture management support garment is a moisture transporting sport bra. A denier differential is employed to provide superior moisture transporting and evaporation of perspiration from a wearer during exertion. The denier differential relies upon a facing layer and a back layer with substantially different yarn thickness and fabric porosity to achieve fluid transport.
US08702467B2
An improved durable toy glider plane comprised of a pliable deformable material, including a Mylar polyester film with a mil thickness that allows the material, once permanently creased under a certain pressure, to have the ability to be deformed by a pressure less than that of the original pressure, such as internal deformation caused when the plane strikes an object, and deformation by external forces, such as when persons bend or crumple the plane, or when the plane is run over by a vehicle, and reform to its original shape when released. The glider plane comprises a swept-wing configuration with winglets and ailerons for flight control and a launch pin to permit accelerated launches and provide weight for the nose of the craft.
US08702464B2
A method of manufacturing an organic EL display device that includes an element substrate on which a first organic luminescent material and a second organic luminescent material are formed, includes forming the first organic luminescent material by dripping the first organic luminescent material from an inkjet nozzle on the element substrate while relatively moving the inkjet nozzle and the element substrate in a first direction, and forming the second organic luminescent material by dripping the second organic luminescent material from an inkjet nozzle on the element substrate while relatively moving the inkjet nozzle and the element substrate in a direction perpendicular to the first direction.
US08702452B2
A connector includes a housing, and contacts received in the housing. The contacts include first contacts and second contacts alternatively arranged with the first contacts. The first contacts include a ground contact and two pairs of differential pair. Each first contact includes a first contacting portion, a first termination portion extending beyond the housing and a first intermediate portion. The second contact includes a second contacting portion, a second termination portion extending beyond the housing and a second intermediate portion. The distance between the first intermediate portion of the differential pair of the first conductive contact and the second intermediate portion of and adjacent second conductive contact is bigger than or equal to the width of the first intermediate portion of the differential pair, and the width of the first intermediate portion is bigger than that of the second intermediate portion of the second conductive contact.
US08702449B2
A connector assembly including at least an insert (1), the insert including: a front part (11) and a rear part (10) made from a hard insulating material, joined together, at least one longitudinal housing (12) crossing through the front part (11) and the rear part (10) of the insert, this longitudinal housing (12) being capable of accommodating a female electrical contact (6), characterized in that the insert (1) includes at least one soft insulating material (20, 21) at least partially surrounding the female electrical contact (6) and absorbing the vibration of the female electrical contact.
US08702438B2
The invention relates to an electrical plug connection element (1) having a contact member (16) which can be deformed in a spring-elastic manner and to which the plug connection element (1) can be electrically connected when it is plug-connected to a further plug connection element (2), characterized in that the plug connection element (1) has a clamping element (40) by means of which the contact member (16) and/or a separate spring (20) which supports the contact member (16) when contact is made can be deformed in a spring-elastic manner in such a way that the force which is required to plug-connect the plug connection element (1) to the further plug connection element (2) is reduced, and in that the action of the clamping element (40) can be removed by the plug connection element (1) being plug-connected to the further plug connection element (2), and as a result the contact member (16) can be brought into contact with the further plug connection element (2) so as to establish an electrical connection by way of the provided contact force.
US08702436B2
The universal plug adaptor contains a terminal set for contacting plug pins housed between a face plate and a casing. The face plate contains a number of sets of plug holes. A first hole set contains a first live hole, a first neutral hole, and a first ground hole conforming to the South Africa specification. A second hole set contains three separate openings, each containing a number of plug holes for ground pins of various specifications. A third hole set contains two plug holes conforming to global 250V specification with two flat pins or two round pins. A fourth hole set contains two plug holes conforming to America 125V specification's two flat pints or two round pins. And a fifth hole set contains two plug holes conforming to America specification with two flat pins. The third and fourth hole sets jointly provide two plugs' simultaneous plugging.
US08702425B2
A temporary supraconstruction for a dental implant or a core for a temporary supraconstruction for a dental implant, characterized in that it includes a material having a modulus of elasticity of less than 300 MPa, preferably in the range of from 15 to 20 MPa.
US08702424B2
A dental implant assembly (20) for transferring forces from a tooth replicating device (22) to a bone (24) of a person. The implant (26) has an exterior surface (32) defining an abutment portion (36) for engaging the tooth replicating device (22) to receive the forces and a lower portion (34) axially below the abutment portion (36) for engaging the bone (24). A collar (38) is disposed about and extends radially outwardly from the lower portion (34) for engaging the bone (24) and for transferring the forces from the implant (26) to the bone (24). The implant (26) defines an inner pocket (48) extending along the axis (A), and a rod (50) is disposed in the inner pocket (48) of the implant (26) and extends along the axis (A) between the lower and abutment portions (34, 36) for transferring the forces received by the abutment portion (36) to the collar (38) disposed about the lower portion (34).
US08702414B1
The invention comprises a die apparatus including a flexible lip for adjusting a gap between the flexible lip and a second lip. The apparatus includes linear moving members that are adjusted through operative communication with gradients on a slide bar. Ball bearings may be in operative communication with the gradients of the slide bar. Movement of the slide bar causes the ball bearings to move linearly, which, in turn, cause the linear moving members to move in a similar linear direction. The moving members operatively communicate with the lip. As a result, the dimensions of the gap may be changed by moving the slide bar in a first direction.
US08702412B2
Embodiments of the invention relate to injection mold components, assemblies, and molding system that include superhard materials. Such injection mold components, assemblies, and systems may decrease wear of certain injection mold components, which may result in improved productivity of the injection mold and molding systems that utilize such components.
US08702407B2
A multistage vacuum pump includes a stator housing a multistage rotor assembly, each stage having intermeshing Roots rotor components, wherein the tip radius of the rotor components at an inlet stage of the pump is larger than the tip radius of the rotor components at an exhaust stage of the pump, wherein a meshing clearance between the rotor components at the inlet stage of the pump is greater than a meshing clearance between the rotor components at the exhaust stage of the pump.
US08702399B2
A Pump consisting of a pressure vessel (50), an inlet nozzle (51), an ejector nozzle (52) by which vacuum and pressure are applied, and an outlet nozzle (53). The inlet and outlet nozzles (51, 52) are selectively closed by interconnected knife gate valves, operated in tandem by a pneumatic cylinder whereby when one valve is closed, the other is open an vice-versa. An ejector valve located in the ejector nozzle (52) alternately creates vacuum and generate air flow through the vessel (50). The air from the ejector is introduced into the discharge line after closure of the outlet valve.
US08702396B2
Provided is a separative tidal current rotor blade including: a hub constituting a body of a rotor; a blade formed by coupling a plurality of blade blocks together; a connecting member for connecting the hub and the blade; and a coupling unit for coupling one end of the connecting member to the hub. The blade can be mass produced and has excellent compactibility by dividing a body unit of the blade into a plurality of blocks and assembling the blocks. Also, manufacturing and maintenance costs and time can be reduced since the body unit of the blade is divided into the blocks. In addition, the blade can be prevented from being damaged since a shock absorbing member is disposed between blade blocks to absorb a sudden shock.
US08702391B2
A gas turbine blade including a root and an air foil with a leading edge and a trailing edge, a cooling air channel system extending from a cooling air opening in the root via a winding serpentine channel to a trailing edge channel at the trailing edge including an air outlet at the trailing edge is provided. For efficiently cooling the trailing edge of the blade it is proposed that the cooling air channel system includes an air bypass channel connecting the cooling air opening in the root with the trailing edge channel bypassing the serpentine channel.
US08702389B2
A device for locking a rotor blade of a wind turbine which has an adjustment system for the blade pitch angle of the rotor blade, wherein the adjustment system has a drive which features a motor and a gearbox with an input shaft that bears an external toothing, characterized by a locking pin rotatably mounted around its longitudinal axis, which engages with the external toothing in a locking position, and releases the external toothing in an unlocked position, wherein the locking pin has an end portion whose free end stands eccentric to the longitudinal axis of the locking pin.
US08702384B2
A turbomachine component includes a compressor stator vane having an airfoil core shape. The airfoil core shape includes a nominal profile substantially in accordance with Cartesian coordinate values of X, Y, and Z set forth in TABLE 1, and wherein X and Y are distances in inches which, when connected by smooth continuing arcs, define airfoil profile sections at each distance Z in inches. The profile sections at the Z distances are joined smoothly with one another to form a complete airfoil core shape.
US08702382B2
A composite component such as a fan rear seal comprises a hub and a body of composite material which is molded over the outer periphery of the hub. The body is formed from a preform of fiber reinforcement impregnated with a resin, in a compression molding process. The body has an annular projection provided with a sealing surface. The sealing surface may comprise circumferential fins, or may be a surface of, for example, an abradable seal insert molded into the composite material of the body.
US08702366B2
A system, method, and apparatus for palletizing cargo on a rack for shipment are provided. The system generally includes a tiered rack having a base tier, a support framework extending from the base tier, and a second tier adjustably attached to the support framework. The system may further include a plurality of lower frame support members positioned longitudinally across the bottom of the base tier, and a plurality of pneumatically actuated rollers spaced to cooperatively engage the plurality of lower frame support members, the rollers being selectively extendable from a plurality of raised tracks positioned longitudinally along a floor of the railcar, where the rollers are configured to pneumatically extend past an upper surface of the track when actuated and allow for linear motion there over.
US08702362B2
An unconventional bolt includes a main body having two heads, and two threaded rods respectively formed at the external surface of each head coaxially with the main body, wherein the cross section of each head has a noncircular shape, and the axial projection of the cross section of the middle of the main body is located in the noncircular axial projection of each head of the main body. The unconventional bolt has a simple structure and a convenient assembly, and can improve the strength and rigidity of the nested profiled components after the connection; and the fastening device using the unconventional bolt can not only support the component but also reinforce it, thus effectively preventing the nested profiled components from transforming.
US08702357B2
One non-limiting aspect of the present disclosure is directed to a multi-piece spade drill head for a spade drill, wherein the spade drill includes an elongate body portion and a cutting portion removably secured to an end of the body portion. The multi-piece spade drill head includes at least two insert pieces, each piece including a cutting edge. The at least two insert pieces are configured to be removably secured to the body portion of the spade drill adjacent one another and with the cutting edges of the insert pieces aligned to together form a cutting edge on an end of the spade drill.
US08702348B2
An apparatus for moving an elongate component within or through a sidewall of a pit, including a frame, a lever arm pivotably attached to the frame and comprising a handle at a first end, a gripping arrangement pivotably attached to the lever arm at a second end at a gripping pivot point, allowing the gripping arrangement to pivot about the gripping pivot point to assume a first and a second installation position, wherein in a first installation position during use the gripping arrangement grips the elongate component as the lever arm pivots in a first direction and releases the elongate component as the lever arm pivots in a second, opposite, direction, and wherein in a second installation position during use the gripping arrangement releases the elongate component as the lever arm pivots in a first direction and grips the elongate component as the lever arm pivots in a second, opposite, direction.
US08702347B2
A device for protecting a subsea structure from damage due to impact from falling objects. The device includes a lower shell that can be positioned over the subsea structure on the sea bed. The lower shell has a non-articulating cross sectional shape that provides a conduit between the lower shell and the sea bed. An upper shell is fixed to an outer surface of the lower shell and has a cross sectional shape that provides a conduit between the outer surface of the lower shell and the upper shell. The upper shell is sized and configured to be disposed on the lower shell. The lower shell can include footings to providing bearing support on the sea bed or may be positioned on separate footings or foundation on the sea bed. Methods of making the device and using the device to protect subsea structures are also disclosed.
US08702340B2
An integrated locking device that includes both a linear locking mechanism and a rotary locking mechanism. The locking device includes a housing where the linear locking mechanism and the rotary locking mechanism are mounted to different sides of the housing so as to reduce the height of the device.
US08702333B2
The invention relates to a quick-fastening applicator closure comprising a cap-side closure member and a container-side closure member which are twisted relative to one another in order to fix the applicator on the storage container associated with it. A multi-start, preferably double-start, short-threaded portion is provided on at least one of the closure members, whose threads are designed in such a way that the two closure members can be brought from a position in which the threads of the short threaded portion grip for the first time into a fully closed position with a rotary movement less than a ⅜ rotation relative to one another, with additional retaining elements being provided which hold the two closure members firmly against each other in addition to the thread friction that is present anyway, once they have reached their fully closed position.
US08702330B2
A printer has a roll paper compartment that stores roll paper so that it can roll on a horizontal axis of rotation, a roll paper cover that pivots to open and close the roll paper compartment, and a tension roller that is displaced when the roll paper cover pivots open and closed. The roll paper compartment is supported to pivot in the direction in which the roll paper cover rotates when the roll paper cover pivots open or closed. The tension roller is disposed to a position where it urges the roll paper opposite the direction in which the roll paper compartment moves circularly when the roll paper cover pivots in the opening direction.
US08702329B2
A label printer for performing printing on a label temporarily adhered to a pasteboard of a sheet roll includes a main body on which a platen roller and a peeling bar are mounted, an installing part configured to have the sheet roll installed therein, an installing cover configured to close when the sheet roll is installed in the installing part, and a printing head and a peeling roller mounted to the installing cover. The peeling roller is configured to move along a groove formed in the installing cover and contact the platen roller when the installing cover is closed. The peeling bar is configured to peel the label from the pasteboard by bending the pasteboard after the pasteboard is wrapped around the peeling bar and is conveyed between the peeling roller and the platen roller.
US08702327B2
In a telescoping camera crane arm, a second section is telescopically extendible into and out of the first section. The second section divided into a front segment attached to a back segment by a connector, to allow the front segment to be removed from the back segment. An adapter is attachable to the front end of the first section. A camera support attachable to the adapter and to the front end of the front segment. To configure the crane for increased maximum payload, the front segment is removed from the back segment. The adapter is attached to the front end of the front section, and the camera support is attached to the adapter, so that the camera support is then supported directly by the first section. A spring balancing system compensates for out-of-balance forces associated with changes in the elevation angle of the crane arm.
US08702325B2
A connector assembly includes a plug connector (1000) electrically and optically connecting with a receptacle connector (2000). The plug connector (1000) includes a first insulative housing; a terminal module supported by the first insulative housing, the terminal module including a plurality of terminals combined with an insulator; at least one optical member (8) mounted to the first insulative housing; the optical member and the terminal module arranged at opposite sides of the first insulative housing. The receptacle connector (2000) includes a second insulative housing; a contact module supported by the second insulative housing, the contact module including a plurality of contacts combined with a contact seat; at least one optical module (208) mounted to the second insulative housing; and wherein the contact module is adapted for mating with the terminal module transmitting electrical signal; wherein the optical member is adapted for mating with the optical module transmitting optical signal.
US08702323B2
A connector including a housing having a distal end and a proximal end has a ferrule assembly having a ferrule and a ferrule spring. The ferrule spring biases the ferrule in a distal direction. A boot is mounted at the proximal end. The boot has a distal end mounting over the proximal end of the housing and a proximal end and defines a central axis. A central passage extends through a length of the boot. A strain relief portion is adjacent the proximal end of the boot and has a truncated, conical outer shape formed by co-axial rings separated by gaps, the rings being interconnected by links extending across the gaps. The central passage has a proximal portion corresponding to a length of the strain relief portion that defines a transverse cross-dimension A majority of the rings have radial thicknesses at least 50 percent as long as the transverse cross-dimension.
US08702321B2
The invention provides improved multi-fiber, fiber optic probe assemblies in which the component parts are adapted for rapid assembly with precise alignment. Some embodiments are adapted to illuminate and collect light from a sample at a particular depth while minimizing interference arising from within the probe assembly itself. Also provided are methods for manufacturing the probe assemblies and optical apparatuses including the probe assemblies.
US08702320B2
A fiber optic ferrule assembly includes a ferrule with an axial passage, an insert with an axial passage, and a hub with an axial passage. The axial passage of the ferrule includes a first diameter portion having a diameter of at least 125 microns, and the axial passage of the insert includes a second diameter portion having a diameter of at least 250 microns. The axial passage of the hub holds at least a portion of the ferrule and the insert. The fiber optic ferrule assembly terminates a fiber optic cable including an inner fiber, an outer coating around the inner fiber, and a buffer layer around the outer coating. The first diameter portion only receives the inner fiber and no outer coating, and the second diameter portion receives at least a portion of an exposed portion of the outer coating and no buffer layer. Minimal epoxy is applied around a transition area near an end of the outer coating. A method of assembling a terminated fiber optic cable is also provided.
US08702319B2
A cable assembly (1000) includes an insulative housing (1); a terminal module (22) assembled to the insulative housing, the terminal module including a plurality of terminals (222) combined with an insulator (221); at least one lens (81) supported by the insulative housing; a cable (6) having a plurality of wires (61, 62), a fiber (65) and a strength member (66), the wires electrically connected to the terminals, the fiber optically coupled with the lens; and an anchoring member (9) having a holding portion (91) combined with the strength member (66) and a locking portion (92) engaged with the terminal module.
US08702316B2
Circuits, apparatus, and methods that provide a connector system that can supply both power and data to a mobile computing or other type of device using a single connection. Further examples also provide a power and data adapter that can provide power and data to a mobile computing device using a single cable. Further examples provide an easy disengagement when a cable connected to the connector is pulled. One such example provides a magnetic connector that uncouples without binding when its cord is pulled. Another example prevents power from being provided at a connector insert until the connector insert is placed in a connector receptacle.
US08702305B2
In a temperature sensor (1), a pair of electrode wires (25) of a thermistor element (21) are formed of a material prepared by adding strontium to platinum or a platinum alloy and without addition of zirconia or a like oxide. Rear end portions of the electrode wires (25) formed of the above-mentioned material and front end portions of sheath core wires (3) are laser-welded to one another in an overlapping condition.
US08702297B2
Methods and systems for chemical management. In one embodiment, a blender is coupled to a processing system and configured to supply an appropriate solution or solutions to the system. Solutions provided by the blender are then reclaimed from the system and subsequently reintroduced for reuse. The blender may be operated to control the concentrations of various constituents in the solution prior to the solution being reintroduced to the system for reuse. Some chemicals introduced to the system may be temperature controlled. A back end vacuum pump subsystem separates gases from liquids as part of a waste management system.
US08702292B2
In various embodiments, LED-based illumination devices include an inlet region for receiving the LED light that is complementary in shape to the lens of the LED.
US08702287B2
A lighting fixture can include a light source, and a lens body including an incident face through which light emitted from the light source enters the lens body, an exit face, and a reflecting face configured to reflect light which has entered the lens body from the incident face such that the reflected light is emitted from the exit face to form a predetermined light distribution pattern having a boundary line between light and dark. The reflecting face can include a first reflecting region configured to reflect light with a reference wavelength which has entered the incident face perpendicularly with respect to the incident face. A second reflecting region can be configured to reflect light with a wavelength longer than the reference wavelength. A third reflecting region can be configured to reflect light with a wavelength shorter than the reference wavelength.
US08702286B2
A vehicle light can prevent color variations in a projected image. The vehicle light can include a light source, a wavelength conversion member including a phosphor configured to receive blue light having been emitted from the light source and then emitting white light, and a reflector having a reflection surface that reflects the white light having been emitted from the wavelength conversion member. The reflection surface of the reflector can have an optical structure that can diffuse the blue light incident on the reflection surface from the phosphor, reflect the blue light back to the phosphor, or allow the blue light to pass through the reflection surface to the area rearward thereof.
US08702285B2
A vehicle light is provided which can form a light distribution pattern having a clear cut-off line. The vehicle light can include a semiconductor light emitting device as a light source. The semiconductor light emitting device can include a semiconductor light emitting element having a light emission surface thereof having a first end and a second end and at least one light extracting layer deposited on the light emission surface and including a wavelength conversion layer, and the light extracting layer includes an optical characteristic that can change from the first end to the second end in a direction parallel to the light emission surface so that the semiconductor light emitting device forms a luminance distribution with a maximum luminance at the first end and a minimum luminance at the second end.
US08702283B2
The invention is a grow light with reflectors that serve to conceal a vacuum air flow system. The air flow system does not interfere with the reflectors, which enables the reflectors to more efficiently reflect light to the plants being grown.
US08702276B2
The present invention relates to an illumination device comprising at least one light source generating a light beam and at least one light beam diffractor. The light diffractor is positioned at least partially in the light beam and adapted to diffract at least a part of the light beam. The light beam diffractor includes a first diffractor section and a second diffractor section which can be moved in relation to the light beam and independently of each other. The present invention relates also to moving head light fixtures and method of forming a light beam.
US08702274B2
A lighting device, having at least one light outlet opening and at least two different fixing interfaces for the optional fixing of a respective attachment element optically upstream of the at least one light outlet opening.
US08702271B2
Lighting devices and/or systems offer dynamic control or tuning of color of light. The lighting systems utilize sources, such as solid state sources, to individually pump a number of different phosphors of types having relatively high degrees of color purity. The phosphor emissions, however, are still broader than the traditionally monochromatic color emissions of LEDs. The different phosphors can be independently excited to controllable levels, by individually controlled sources rated for emission of energy of the same spectrum. Adjustment of intensities of electromagnetic energy emitted by the sources independently adjusts levels of excitations of the phosphors selected to emit different colors of relatively high purity and thus the contributions of pure colors to the combined light output, for example, to enables color adjustment of the light output over a wide range of different selectable colors encompassing much of the gamut of visible light.
US08702264B1
An LED or fluorescent recessed lighting fixture having a pair of aligned LED boards or a pair of fluorescent bulbs each shielded by a diffuser. Each diffuser is retained by an angled wall and a portion of a V-shaped diffuser cover. The apparatus includes light emitted from a light source toward the location where the light is to illuminate the area. A reflector assembly is set in a straight line at an angle in the range of 45 degrees. A lens covers the light source and is retain by a portion of the reflector and a V-shaped basket.
US08702260B2
This invention relates to an ambience lighting system for a display device for emitting an ambience light onto a wall behind the display device. Light sources are placed at the rear side of the display device along with a reflector, where the internal arrangement of the light sources and the reflector is such that when the display device is placed in proximity to the wall the light emitted by the at least one light source becomes reflected by the reflector towards the wall such that the reflected light at least partly peripherally surrounds the viewing area of the display device.
US08702258B2
A compact illumination optical system manufactured at reasonable cost can be provided. The illumination optical system can include: a light source for emitting a light beam; a hologram element for converting the light beam emitted from the light source to reproduced light having a predetermined shape of light distribution and a predetermined luminance distribution; a fluorescent plate containing a fluorescent material for emitting visible light by absorbing the reproduced light emitted from the hologram element and entering the fluorescent material; and a lens for projecting forward the visible light emitted from the fluorescent plate.
US08702253B2
In certain examples, heat treatable coated articles, e.g., suitable for concentrating solar power (CSP) and/or other applications, may be provided. For instance, the heat treatable coated article may be a secondary reflector panel, primary reflector, etc., where a reflective coating is disposed on a glass substrate. A portion of the reflective coating may be removed and a frit material is disposed over the reflective coating. An elevated temperature may be applied to the glass substrate, the coating, and the frit material where the frit is cured. The coated article may be left flat, or optionally cold- or hot-bent into a desired shape suitable for a desired application.
US08702248B1
A display system able to reduce interpixel intensity gaps caused by the use of pulsed laser sources having relatively short optimum pulse duration. The interpixel intensity gaps are reduced by temporally offsetting multiple laser pulses for a display pixel during a corresponding pixel-scan period. The temporally offset pulses for the display pixel are then scanned to different locations on a viewing surface such that the display pixel has an improved intensity distribution. Additional reduction in the interpixel gaps may be accomplished by de-focusing the temporally offset pulses in a scan direction, increasing the duty cycle of the source lasers, and shifting the location of alternating frames on the viewing surface.
US08702242B2
A projector includes a wireless device performing a predetermined function, an external housing which accommodates a light modulation device, a first controller, and the wireless device, an intake fan which introduces air outside the external housing into the external housing through an inlet port, an exhaust fan which discharges the air introduced into the external housing through the inlet port to the outside through an outlet port, a first channel which guides the air introduced through the inlet port toward the light modulation device by the drive of the intake fan, and a second channel which guides the air introduced into the external housing toward the exhaust fan via the wireless device by the drive of the exhaust fan.
US08702236B2
A binocular pupillometer apparatus is provided with processing means to calculate the relative afferent pupillary defect (RAPD) in a subject. The RAPD is calculated as the shift required to bring the two pupillary responses of the left and right eyes into coincidence. Where the responses are not parallel, modified pupillary responses are determined having the same area difference between the responses and an average rate of change with respect to stimulation intensity. The RAPD is calculated from the modified pupillary responses rather than the observed responses. Improvements to the pupillometer include a divider positioned between the left and right stimulating channels.
US08702233B2
A vision exercising apparatus including a visual display device (1); a locating means (5) for locating the head of a user at a position to provide a substantially known relationship between the visual display device (1) and the field of view of the user; display position control means for actuating the visual display device (1) to display a predetermined pattern at a known display position which corresponds to a specific viewing area of the field of view of the user; user actuable response means (17) to enable a user response to be provided; further control means to control the display position control means to repeatedly display the predetermined pattern at the known display condition; and means to collate user response and to evaluate the statistical significance of the user response for that display position. A predetermined pattern can thus be displayed in the field of view of a user that requires exercising.
US08702231B1
Sunglasses replaceably attached to conventional spectacles. The sunglasses include a frame, a pair of tinted lenses, and two pair of attachments. The frame replaceably attaches to a frame of the conventional spectacles. The pair of tinted lenses are attached in the frame. The two pair of attachments extend from the frame and replaceably snap the sunglasses onto the frame of the conventional spectacles to eliminate inadvertent movement of the sunglasses relative to the conventional spectacles during use without impinging upon hinges of the frame of the conventional spectacles so as to allow the sunglasses to fold with the conventional spectacles.
US08702230B2
An attachable/detachable covering lens for covering eyeglass lenses is disclosed. A transparent optical material is suitably shaped to cover at least a portion of an eyeglass lens. The transparent optical material is coupled to the eyeglass lens by adhering means. The adhering means may comprise a viscosity of the transparent optical material. Embodiments of the disclosure provide mechanisms to easily provide attachable/detachable temporary lenses such as a sun-shield, temporary eyesight correction to the prescription lenses for applications such as reading, watching TV, or 3-D movie viewing. Embodiments of the disclosure also provide mechanisms for providing an easily attachable/detachable temporary prescription lens over special purpose glasses.
US08702228B1
Inkjet printing systems are provided that use a cross-module airflow to limit condensation between a printing module and a receiver and that supply a co-linear flow of air that flows along with ink droplets toward a receiver. An integration area is created between the inkjet printhead heads, the receiver and a barrier to allow co-linear flow and cross-module flow to integrate and flow from between the printing module and the receiver without disrupting travel paths of the ink droplets.
US08702210B2
A configuration is provided in which at least one end of a piezoelectric body active portion is defined by an end of a second electrode, a portion of configuring the piezoelectric body active portion of a first electrode is covered with a piezoelectric body layer, the first electrode and the piezoelectric body layer are extended to the outside of the end of the second electrode which defines the end of the piezoelectric body active portion, the first electrode includes an exposure portion which is not covered with the piezoelectric body layer and extends further outside than the end of the second electrode, and on the end of the piezoelectric body layer which forms the exposure portion, an independent electrode which is electrically independent from the second electrode is provided.
US08702208B2
A system for achieving accurate page yields includes a first droplet generator comprising a nozzle aperture with a first cross sectional area and a first passageway to an ink reservoir. A second droplet generator includes a nozzle aperture with a second cross sectional area that is larger than the first cross sectional area and a second passageway to the ink reservoir with minimum cross sectional area that is smaller than the second cross sectional area. A method for achieving accurate page yields is also provided.
US08702201B2
An ink discharge apparatus is provided, including a discharge head which has a nozzle surface formed with a first nozzle for discharging an ink of a first color and a second nozzle for discharging an ink of a second color darker than the first color; a cap; a sucking mechanism which performs suction for a space in the cap; a moving mechanism which positions the cap at a capping position and at a retracted position; and a purge control mechanism which controls the moving mechanism so that the cap is separated from the nozzle surface while allowing a second distance between the cap and an area near the second nozzle to be smaller than a first distance between the cap and an area near the first nozzle after completion of a purge operation.
US08702190B2
A liquid jet head has a piezoelectric, a pair of electrodes for applying an electric field, and a drive section for driving the piezoelectric body. The drive section drives the piezoelectric body by setting a voltage of one of the electrodes to a first low voltage having a relatively small absolute value, and by supplying a drive signal of one polarity to the other electrode. The driving section restores the piezoelectric body by setting the voltage of the one electrode to a high voltage having the same one polarity as the drive signal and having a relatively large absolute value, and by setting a voltage of the other electrode to a second low voltage having a relatively small absolute value. The drive section applies a voltage for generating an electric field exceeding a coercive field of the piezoelectric body to the pair of electrodes.
US08702185B2
A refrigerator appliance is provided. The refrigerator appliance includes a drawer received within a chilled chamber. The drawer is mounted within the chilled chamber using drawer slides. The drawer slides are positioned at a bottom of the chilled chamber and support a bottom portion of a basket mounted on the drawer. Such a configuration can increase actual and/or perceived storage space within the chilled chamber and provide other improvements.
US08702184B2
A locking mechanism for an enclosure. The locking mechanism includes a housing with an outer surface having a first tab fixedly attached to the housing. The housing is adapted to be coupled to a door by pressing the housing through a latch housing of a latching mechanism of the door until the first tab springs out and locks the housing in place in the latch housing. The locking mechanism includes an insert adapted to be positioned through the housing and adapted to be coupled to a flange of the latching mechanism of the door. The insert includes either a handle or a knob. Rotation of the insert rotates the flange to lock the door.
US08702179B2
A brake system for a vehicle includes brake cylinders operated by pressurized fluid for actuation of brakes by means of pressurized fluid on at least one first axle of the vehicle. The brakes on at least one other, second, axle can be actuated exclusively electromechanically in response to an electrical braking request signal. The pressure of the pressurized fluid can be modulated indirectly or directly and the electrical braking request signal can be generated indirectly or directly in response to actuation of a brake pedal of a brake pedal device. A service brake function is provided by means of hybrid use of the brakes on the first axle(s) together with the brakes on the second axle(s). The brake cylinders operated by pressurized fluid are pneumatically operated brake cylinders. The pressure modulated by the brake pedal device is a pneumatic pressure, and the pressurized fluid is compressed air.
US08702172B2
A vehicle seat, such as a rear bench seat, includes a seat part, a backrest part and a fitting part. The backrest part and the fitting part are pivotable relative to the vehicle body about a first rotational axis. The first rotational axis is disposed below the seat part or behind the backrest part.
US08702170B2
A vehicle seat includes a seat part and a backrest which is provided at the seat part so as to be rotatable, wherein the seat part and the backrest can be transferred into an easy entry position.
US08702164B2
A heated seat comprising: a cushion with one or more trench areas; a heater comprising: a carrier with a periphery, the carrier further including: a first electrically functional layer that is made of a conductive material that substantially circumscribes at least a portion of the carrier; and a second electrically functional layer that is made of a resistive material; one or more electrical conductors attached to the first electrically functional layer; a trim layer that covers the cushion when the heater is placed over the cushion; and wherein the periphery includes a first side edge and a second side edge, and each side edge includes a cutout, and the cutouts are located adjacent to each other forming a neck portion; wherein the heater is attached to the cushion by placing an attachment device over the neck portion of the heater and securing one or both ends of the attachment device to the cushion so that the neck portion is pulled into the trench; wherein the neck portion is free of the second electrically functional layer; and wherein the first electrically functional layer and the second electrically functional layer form a checkered pattern.
US08702161B2
An energy absorbing and distributing side impact system for use with a vehicle is provided, the system utilizing a collapsible side sill along with multiple vehicle cross-members to achieve the desired level of vehicle side impact resistance, the combination of these elements absorbing and distributing the impact load throughout the vehicle structure. A battery pack enclosure that includes a plurality of cross-members that transverse the battery pack enclosure also help to absorb and distribute at least a portion of the load received when either the first or second side of the vehicle receives a side impact. In this configuration the battery pack enclosure is positioned between the front and rear vehicle suspension assemblies and mounted between, and mechanically coupled to, the side sill assemblies. In addition to providing rigidity, strength and impact resistance, the battery pack cross-members segregate the batteries contained within the battery pack enclosure into battery groups.
US08702155B2
A cowl louver sealing structure that is capable of being positioned between a cowl louver and a hood of a vehicle may include an elastic sealing member capable of closing a space between an inner surface of the hood and the cowl louver. The sealing member is directly attached to the cowl louver.
US08702149B2
In a method for the production of a dashboard support for a motor vehicle, a blank is cut from an extruded profile part. The blank is then trimmed and shaped to form a mount which is connected to an end of a crossbeam for allowing subsequent coupling of the crossbeam via the mount to an A-pillar of the motor vehicle.
US08702145B2
A cargo area assembly for a movable seat in an automotive vehicle includes a configurable panel covering at least a portion of a storage compartment located rearwardly of the seat. The configurable panel and a removable panel cooperate to cover the storage compartment, if desired, in a full forward and full rearward position of the seat. The configurable panel incorporates hinges to allow various positioning of panel portions and storage alternatives, and the removable panel is dimensioned for storage in the tailgate.
US08702141B2
An object-carrying tray is provided that can be used by both left and right-handed users. The tray has a flat upper surface and a lower surface having a molded depression of two hands. The hands are positioned so that the palms, and several inner fingers overlap and the thumbs point in opposing directions. This configuration permits both a left or right-handed user to place his or her hand within the depressions. The user places his or her hand within the appropriate depressions to reduce the likelihood that the tray will slide around on a user's hand while the device is in use.
US08702133B2
An actuator for an electronic door lock includes a stationary first magnet assembly, a beam, and a second magnet assembly. The first magnet includes at least one magnet stationarily positioned within the electronic door lock. The beam is movable relative to the first magnet assembly to a first position and a second position. The second magnet assembly is connected to the beam and is configured to be magnetically repulsed away from the first magnet assembly. The repulsion of the second magnet assembly maintains the beam in either the first or second position until the beam is selectively actuated therefrom.
US08702131B1
The mortise lock of the invention has an adjustable backset employing a latch bolt spacer, a dead bolt extender and two body spacers between the mortise lock body and mortise lock face plate. All the spacers are removable.
US08702129B2
A system for forming a fluid connection includes a first connector and a second connector. Both connectors include a tubular body having a membrane mounted on a distal end thereof. A support member facilitates the coupling of the connectors together so that the membranes are abutted together. Radiant energy is applied to the abutted membranes so as to first sterilize the membranes and then melt the membranes so that a passage is formed therethrough.
US08702126B2
A pencil brace is incorporated into a cross car assembly of an automotive vehicle as a secondary energy absorption device to assist in managing the energy and controlling the column stroke due to a collision.
US08702116B1
An aerodynamically shaped seat post fabricated from carbon fiber is mountable to a seat tube by placing left and right bushings within the hollow center of the seat post. These bushings are accessible and engageable to left and right bolts when the desired height of the seat post is reached. In particular, the left and right bolts are fed through left and right holes formed in the seat tube. The seat post has left and right elongate slots which provide access to the bushings, and more particularly, to the threaded holes of the bushings so that the left and right bolts may engage those threaded holes and clamp the left and right sidewalls of the seat post and the left and right sidewalls of the seat tube together, respectively. This seat post mount eliminates stress concentrations to the seat post. Moreover, the seat post is not clamped down with opposed forces placed on the left and right sidewalls of the seat post.
US08702106B2
A seal assembly disposed within a radial seal groove to sealingly engage a bonnet within a bore. The seal assembly includes a radial seal surface, an axial seal surface, a vent surface, and an axial preload surface. The seal assembly is thrust towards a longitudinal wall and away from a radial wall of the radial seal groove when pressure in a high-pressure zone increases.
US08702098B2
A printing system includes a marking engine for applying a marking substance onto a sheet and a sheet conveying device. The sheet conveying device includes a belt arranged to carry sheets from an upstream end to a downstream end of a transport path, the belt having an array of perforations; an array of suction nozzles arranged below the belt for sucking-in ambient air through the perforations of the belt; and at least one blow nozzle arranged at the downstream end of the transport path for blowing out a gas through the perforations of the belt. The conveying device further includes an array of anti-friction blow nozzles interleaved with the array of suction nozzles and connected to a blower for blowing-out a gas towards the bottom surface of the belt during the traverse of the sheet along the marking engine.
US08702085B2
Theres is disclosed a device (10) for manufacturing a notepad (15) comprising a stack of sheets, a first side of each sheet having an adhesive to attach the first side to a reverse face of a sheet immediately facing said first side in said stack. The device (10) including a sheet feeder (20) for loading one or more loose sheets (24) of similar dimensions with the reverse face of each sheet (24) in said stack facing in the same direction and feeding each said sheet downstream of said device (10). A cutting means (40) is provided to cut each sheet (24) or a number of said sheets (24) to predetermined dimensions. An adhesive applicator (60) applies adhesive to a portion or portions of the first side of each sheet (24). A stacking means (100) stacks the cut sheets one on top of the other whereby a forming means (120) forms the cut sheets together to form the notepad (15).
US08702084B2
A magnet holding jig comprises a platform and first and second holders disposed on opposite sides of the platform. The platform is provided with channels, the holders are comb-shaped to define digits and slits, the channels and the slits being aligned to define guide paths for permitting entry of a cutting tool therein, and the holders are also configured as digitate hooks. The holder hooks are in contact with a rare earth magnet block resting on the platform. The holders are pushed inward at their lower portions so as to bring each hook digit of the second holder in pressure abutment with the magnet block at a higher level than each hook digit of the first holder for thereby holding the magnet block in place on the platform.
US08702083B2
A magnet holding jig comprises a platform and first and second holders disposed on opposite sides of the platform. The platform is provided with channels, the holders are comb-shaped to define digits and slits, the channels and the slits being aligned to define guide paths for permitting entry of a cutting tool therein, and the holders are also configured as digitate hooks. The holder hooks are in contact with a rare earth magnet block resting on the platform. The holders are pushed inward at their lower portions so as to elastically deform the digitate hook and move it backward and to bring the hook digits in pressure abutment with the magnet block, thereby holding the magnet block in place on the platform.
US08702075B1
A unique, adjustable collar for a shock absorber coil-over spring is positioned on top of the coil-over spring and below the shock lock nut. The collar serves as a bearing that can be adjusted to increase or decrease the tension applied to the coil-over spring making for easier adjustments. The collar in the preferred form has eight (8) conical gears that mate with corresponding teeth in the top. The gears are turned clockwise or counterclockwise to respectively raise or lower the ride height of the vehicle. A typical one quarter inch (¼″) socket extension or similar tool can be used to turn the gears.
US08702067B2
The invention relates to an axial displacement device (3) to be used in conjunction with a rotary winch (2), said winch comprising a drum (7) being rotatable about an axis of rotation (a-a), said axial displacement device to be arranged stationary with respect to said winch and comprising one or more guiding elements (23), said one or more guiding elements being configured to displace a winding of said line in an axial direction parallel to said axis of rotation with at least the diameter of said line, so that a part of said winding being in contact with said drum runs in a plane substantially perpendicular to the axis of rotation.
US08702061B2
A first cutoff valve is disposed in a main duct ranging between a control valve and a bottom chamber of a hydraulic cylinder. A sequence valve in the first cutoff valve is disposed along such a direction as to control outflow of a hydraulic fluid from the bottom chamber and the hydraulic pressure in a rod chamber is applied to the sequence valve as an external pilot pressure. A second cutoff valve is disposed in a main duct ranging between the control valve and the rod chamber of the hydraulic cylinder. A sequence valve in the second cutoff valve, disposed along such a direction as to control outflow of the hydraulic fluid from the rod chamber, and the hydraulic pressure in the rod chamber is applied to the sequence valve as an internal pilot pressure.
US08702054B2
Fastening element (1) for fastening cleaning implements (2) to a cleaning cart (3) with unequal height/width ratios of non-rotationally symmetric supporting tubes (4) comprising a holding section (5) for fastening the fastening element (1) and also at least one first and one second receptacle element (6, 7), wherein these receptacle elements are constructed so that cleaning implements (2) can be attached in at least two different planes.
US08702049B2
An ergonomic portable space saving workstation includes at least one rail, at least one support arm connected to the rail for supporting different types of components, and a mounting interface connected to the rail for connecting the rail to a wall, desktop, or wheel mount. The workstation can be used by individuals in lying, sitting, or standing positions and used with objects of various sizes and shapes, such as computer keyboards, monitors, notebooks, desktop computers, footrests, printers, fax machines, projectors, televisions, canvases, desktop surfaces, whiteboards, or chalkboards. The support arm can be adjusted vertically and horizontally to facilitate use in various positions and with various objects.
US08702045B1
An electronic display and lighting arrangement for viewing by, and illumination for, a person in a resting position includes: an electronic display assembly including a first carriage movable along a translation axis, a first pivot arm coupled to the first carriage with the first pivot arm pivotable about a first pivot axis, and an electronic display coupled to the first pivot arm; and a lighting assembly including a second carriage movable in a direction parallel to the translation axis, and a light coupled to the second carriage and adjustably positionable by movement of the second carriage. The electronic display is adjustably positionable both along the translation axis by movement of the first carriage, and about the first pivot axis by movement of the first pivot arm about the first pivot axis.
US08702030B1
An above-ground pool wall installation apparatus comprises a base and a turntable. The base, made of a resilient material comprises a spherical platform which supports the turntable. A bifurcated rope provided with a handle allows a user to manually pull the apparatus along a pre-determined perimeter, thereby creating the wall of the pool by progressively dispensing the material from a coil mounted onto the rotating turntable.
US08702017B2
A nozzle device comprising a nozzle chamber includes a fluid inlet located at a first side of the nozzle chamber which is operative to introduce fluid into the nozzle chamber in an injection direction and a fluid outlet at a second side of the nozzle chamber which is operative to expel fluid from the nozzle chamber. A high frequency wave generator is also located in the nozzle chamber which is oriented and operative to generate high frequency waves in a direction which is substantially parallel to the injection direction, whereby to impart high frequency energy to the fluid in the nozzle chamber.
US08702014B1
A self-propelled irrigation system includes a drive tower configured to cross over a drainage ditch or other watercourse in an irrigated field without the use of a bridge or other support structure to support the load of the drive tower.
US08702011B2
A barcode structure includes at least one symbolic element row and a frame arranged at a periphery of the at least one symbolic element row. Each symbolic element row has multiple symbolic elements. Each symbolic element has different color from its adjacent symbolic elements, and the color of the frame is different from that of any symbolic element. A barcode encoding method includes: establishing multiple color combinations where a color of a frame is excluded, and each color combination comprising a main color and a sub color; performing a symbolic element row establishment procedure, which includes using a reference color as a color of a first symbolic element of a symbolic element row; deleting color combinations where the reference color is used as a main color; and selecting a color combination from remaining color combinations for coloring two symbolic elements that are sequentially connected with the first symbolic element.
US08702010B2
Disclosed is a processing system and method, the system including a code physically associated with a source. The code includes one or more patterns including a guide pattern arranged in a mark, wherein each pattern includes one or more pattern elements arranged in pattern element zones. Each of the respective pattern has a pattern signature based on a predetermined physical attribute corresponding to the one or more pattern elements within the respective pattern. The system further includes a detection device configured to capture the mark, and a controller coupled to the detection device configured to generate physical attribute data associated with the captured mark, receive the physical attribute data, and determine the pattern signatures by performing an arithmetic calculation on the physical attribute data.
US08702001B2
An apparatus and method for acquiring a code image in a portable terminal includes an image recognizing unit for acquiring a picture including the code image and a code analyzing unit for verifying color information items for pixels with respect to the acquired picture, deleting a certain color information item according to a predetermined scheme when there are a plurality of color information items in order to recognize the code image having at least one of a QR code and a bar code.
US08702000B2
A method for decoding a decodable symbol using an optical reader having a 2D image sensor that is configured to operate in a partial frame capture operating mode. In a partial frame operating mode, the reader clocks out and captures at least one partial frame of image data having image data corresponding to less than all of the pixels of an image sensor pixel array. In one embodiment, the reader operating in a partial frame operating mode captures image data corresponding to a linear pattern of pixels of the image sensor, reads the image data, and attempts to decode for a decodable bar code symbol which may be represented in the image data.
US08701991B2
Systems, methods, and computer-readable media for preventing fraud when exchanging prepaid gift accounts. The system identifies a first prepaid gift account associated with a first prepaid gift. The system then presents an owner of the first prepaid gift with an offer to purchase the first prepaid gift account for an offer amount. Next, the system receives from the owner an acceptance of the offer. Based on the acceptance, the system provides payment to the owner for the first prepaid gift account, generates a second prepaid gift account for a second prepaid gift, transfers at least a portion of funds from the first prepaid gift account to the second prepaid gift account, deactivates the first prepaid gift account, and offers the second prepaid gift account for resale as a new prepaid gift to a person other than the owner.
US08701985B2
A banking system is controlled responsive to data read from data bearing records. The banking system includes an automated banking machine. The machine is operable to carry out a financial transaction for a person responsive to a determination that the person is an authorized user of the machine based on correspondence between identifying data read by a reader of the machine and data store information. The machine includes a check acceptor that is operative to receive checks from authorized machine users. The check acceptor is operable to continuously move a received check along its transport path while simultaneously rotationally orienting the check into alignment with the transport path. A check determined not to have at least one property of an acceptable check is returned to the machine user. Acceptable checks are processed and stored in the machine.
US08701984B1
A banking system includes a plurality of automated banking machines and operates to cause financial transfers responsive to data read from data bearing records. Each machine (10) includes a user interface (16), a card reader (18) of data bearing records, a cash dispenser (42), and other transaction function devices. The card reader operates to read card data corresponding to financial accounts from user cards. In exchange for providing the machines at no charge to a merchant, user transaction fees assessed to machine users are shared by both the machine provider and the merchant.
US08701980B2
A system for tracking one or more subjects for collecting airborne contaminants. The system includes one or more subjects configured to collect air contaminants. Each of the one or more subjects includes an identification tag encoded with identification information identifying the each subject. The system further includes an identification reader configured to decode the identification information encoded within the identification tag of a scanned one of the one or more identification tags. A computer receives and stores the decoded identification information in a record in a database. The computer may also receive and stored an identification code for a user who scanned the scanned identification tag in the record in the database. Additional records in the database are created each time the identification tag of one of the one or more subjects is scanned. The one or more subjects are thereby tracked as they collect airborne contaminants and are incubated.
US08701977B2
In one aspect, an envelope having an integrated return mailing article is fabricated from a single sheet of material having first and second sections, and a perforated line for separably interconnecting said first and second sections. The first section includes bottom, top and side edges and a non-perforated first fold line, a non-perforated second fold line, and a non-perforated third fold line. The second section defines a return mailing article having bottom, top and side edges, at least one of which is coincident with said first perforated line.In another aspect, a multimedia remailable envelope includes an outgoing seal flap, face panel which includes an embedded reply envelope seal flap, a back panel, a face panel for the reply envelope, and side seams for the outgoing face panel. Side seams may also be available and located for the reply envelope.
US08701976B2
A shipping container has a lid locked using pressure, rather than friction. The container includes front and rear side panels and a lid. The lid has a positive locking tab for engaging with a slot in the front side panel. The tab has a greater length than the slot. An end of the tab and an edge of the lid form a notch therebetween. In an embodiment, a corrugated paperboard blank is folded to approximate the lid to the front side panel. The lid is folded along an angled score line, rotating the tab with respect to the slot so that an end of the tab engages the slot and the front panel at an end of the slot engages the notch. The lid is folded to rotate the tab in the opposite direction; the tab then engages with the slot, the end of the tab extending beyond the slot.
US08701972B2
To improve reliability of a semiconductor device, in a flip-chip bonding step, a solder material that is attached to a tip end surface of a projecting electrode in advance and a solder material that is applied in advance over a terminal (bonding lead) are heated and thereby integrated and electrically connected to each other. The terminal includes a wide part (a first portion) with a first width W1 and a narrow part (a second portion) with a second width W2. When the solder material is heated, the thickness of the solder material arranged over the narrow part becomes smaller than the thickness of the solder material arranged in the wide part. Then, in the flip-chip bonding step, a projecting electrode is arranged over the narrow part and bonded onto the narrow part. Thus, the amount of protrusion of the solder material can be reduced.
US08701966B2
The described embodiment relates generally to the field of inductive bonding. More specifically an inductive heater designed for use in assembling electronics is disclosed. A number of methods for shaping a magnetic field are disclosed for the purpose of completing an inductive bonding process without causing harm to unshielded adjacent electrical components.
US08701964B2
There is provided a tool for friction stir welding, which is capable of promoting temperature rise of materials to be joined during joining to achieve friction stir welding in a short time, is excellent in heat insulating property of a coating layer, and is excellent in oxidation resistance and wear resistance. A tool for friction stir welding according to the present invention is a tool for friction stir welding including a base material and a coating layer formed on the base material, wherein the coating layer is formed of one or more layers, and at least one layer of the coating layer has a thermal permeability of 5000 J/s0.5·m2·K or less.
US08701963B2
A medical anastomosis apparatus is provided. The medical anastomosis apparatus includes a cylindrical body which has a hollow portion and extends in a longitudinal direction, a pressing rod which is provided inside of the hollow portion of the body to translate along the hollow portion, a knob which is coupled to the pressing rod to provide a driving force to translate the pressing rod, a guide member which is inserted into one end of the body and simultaneously coupled to expose a portion of the body and has a pressing unit formed therein to move radially upon translation of the pressing rod, and a staple cartridge which is inserted around an outer circumferential surface of the guide member and then coupled to the body and has built-in staple clips that protrude outward upon movement of the pressing unit.
US08701958B2
The present invention includes a surgical stapler having a curved end-effector which is configured to deploy staples in at least one curved staple line. In various embodiments, the surgical stapler includes a staple cartridge, an anvil, and a cutting member having a cutting surface wherein the cutting member is relatively movable with respect to the anvil and the staple cartridge. In one embodiment, the staple cartridge can be configured to deploy staples along different, non-parallel axes. As a result, the staples can be deployed in a significantly curved staple line. In various embodiments, the surgical stapler includes a flexible driver operably engaged with the cutting member to move the cutting member relative to the anvil and the staple cartridge. In these embodiments, the driver can include an elongate cross-section defined by a width and a height wherein its width is greater, and in some cases, substantially greater, than its height.
US08701954B1
Helmet mount apparatus provides a secure helmet holder for mounting a fireman helmet in a fire truck or other emergency vehicle. Three brim brackets, one of which is slidable on a base plate against a spring bias force, clamp the brim of the helmet between the brim brackets. The helmet can be mounted by positioning the brim into the slidable brim bracket and sliding the brim bracket far enough to allow inserting the brim also into the other two brim brackets, and then releasing the helmet to allow the spring bias to clamp the helmet onto the mount apparatus.
US08701953B2
According to one embodiment, an electronic flight bag mounting system a cockpit mounting member coupled to an electronic flight bag mounting member. The cockpit mounting member is configured to mount to a cockpit of an aircraft, while the electronic flight bag mounting member is configured to be coupled to an electronic flight bag. The electronic flight bag mounting member is movable from a deployed position in which a display of the electronic flight bag faces a cockpit seat configured in the cockpit to a storage position in which the electronic flight bag faces away from the cockpit seat.
US08701947B2
A container and dispenser in conical shape for edible or non-edible substances is described.
US08701941B2
A container for dispensing food products can include a clump decimator portion for breaking up food clumps. In one embodiment, a container comprises a container portion having an open interior and an open top and a cover for selectively covering the open top. The cover can include a cover base portion and a rotatable top portion configured to be coupled on top of the base portion. The cover base portion can include a plurality of dispensing apertures for allowing a food product to be dispensed therethrough. The rotatable top portion can be selectively rotatable relative to the cover base portion and the container portion. The clump decimator portion can extend downwardly and radially from the top portion through the cover base portion and into the container portion. The clump decimator can rotate as the rotatable top portion is rotated to agitate the contents of the container portion while they are being dispensed.
US08701935B2
A water gun discharges water continuously by pushing in and pulling out an operating portion and has a casing imitating a barrel, a rear grip portion and a front grip portion. The casing incorporates a pump mechanism and includes pumping tubing forming a pumping path through which water is pumped up from a water storage tank by the pumping mechanism and a muzzle portion disposed at a front end of the casing. The pump mechanism includes a first cylinder and a second cylinder which are oriented in opposite directions, a first piston slidable forwards and backwards within the first cylinder and a second piston slidable forwards and backwards within the second cylinder, an interlocking member coupled to the first piston and the second piston and brought into engagement with a rear half portion of the casing, pumping check valves, a jet water flowing chamber and a water supply path.
US08701928B2
A spout for a spill-proof beverage container has a side wall defining an outer surface and an inner surface defining a discharge passage. A valve in the discharge passage includes two flanks formed integrally with the side wall and projecting from opposite sides of the inner surface of the spout. The front end faces of the flanks mate with one another along a slit that extends generally parallel to the longer axis of the spout. At least the front portions of the flanks are inclined away from the mouth of the spout such that pressure within the container acts to urge the flanks against one another so as to maintain the slit closed. Deformation of the side wall when the spout is held between the lips of a drinker acts to open the slit and create an opening between the flanks to allow the beverage to be discharged.
US08701922B2
A cardboard cover that seals a package and that also enables the resealing of the package. The lower surface of the cover (2) is provided with a downwards directed annular profile (3) made of an injection mouldable material, which enables the resealing of the cover and is placed inside the package when the package is sealed. The invention also relates to a package which is sealed by using the above-described cardboard cover that enables resealing. The invention also relates to a method for manufacturing a card-board cover and a method for sealing a package.
US08701920B2
A fuel cap for a filler neck on a fuel tank includes a cap body having threads for engaging the filler neck when the fuel cap is installed on the filler neck and a cap handle rotatably mounted on the cap body. A clutch acts between the cap handle and the cap body to permit the cap handle to rotate freely on the cap body when the clutch is disengaged. When the clutch is engaged, rotation of the cap handle will rotate the cap body so that the user can remove the fuel cap from the filler neck to refuel the vehicle. A pressure-sensing diaphragm disengages the clutch when the pressure differential between the fuel vapor pressure and the atmospheric pressure exceeds a predetermined threshold and engages the clutch when the pressure differential between the fuel vapor pressure and the atmospheric pressure is less than the predetermined threshold.
US08701916B2
A plastic pan and a plastic drain plug assembly is disclosed. The pan has upstanding walls, a bottom wall, an exterior surface and an interior surface. One of the walls has an opening extending through it. On the exterior, the opening has a circular raised collar with cutouts opposite each other and stop tabs located between the cutouts. On the interior, the opening has a circular raised non-threaded tubular wall. A portion of the non-threaded tubular wall has nibs projecting into the opening. The plug has a head portion, a body portion, an end portion. The head portion has an upstanding crown with downwardly extending tabs located opposite each other. The body portion has a circular groove, and a spiral groove. The end portion of the plug is tapered.
US08701912B2
A window having multiple integral seals, the window being formed of a substantially optically transparent flexible membrane window panel; a substantially continuous peripheral window seal mechanism surrounding the window panel with the window seal mechanism being a continuous peripheral slot having an opening facing away from the window panel and being structured to receive thereinto a substantially rigid inner peripheral window aperture frame; a contoured skirt completely surrounding the window sealing mechanism; a substantially continuous peripheral door seal mechanism formed adjacent to an edge of the contoured skirt; and wherein the window panel, the window seal mechanism, the contoured skirt and the door seal mechanism are mutually integrally formed of a substantially water-resistant and resiliently pliable material.
US08701910B1
An improved wine bottle closure and vacuum pump apparatus is disclosed. The apparatus provides an improved bulb structure to be used for pumping and storage purposes, the bulb remaining with a closure plug even after pumping is completed and the wine is to be stored for later consumption. The bulb structure can be collapsed in two different positions including a first position that maintains overall height of the bulb structure and a second position that enables the bulb structure to be shortened in height as an optional feature. The bulb structure provides an enlarged central section that is much larger in diameter than the lower end portion. The lower end portion provides a closure plug for fitting the opening of a wine bottle.
US08701909B2
The invention relates to a closure device (2) for closing and/or opening an opening (1.1) of a container (1), wherein the opening (1.1) of the container (1) is closed in a first position (I) of the closure device (2) and the opening (1.1) of the container (1) is open in a second position (II) of the closure device (2), and wherein the opening (1.1) of the container (1) has an opening periphery (1.2) which comprises an inner wall (1.3) and outer wall (1.4), and wherein the closure device (2) has a sealing element (4) by means of which the opening (1.1) of the container (1) can be closed with sealing action in the first position (I), and wherein the closure device (2), in the first position (I), is fastened on the container (1) by a closure element (3) and, when the container (1) is opened, can be transferred from the first position (I) into the second position (II) by means of at least one actuating element (3.2) wherein the container opening (1.1) can be opened only by pressure (Pt) being applied to the actuating element (3.2).
US08701900B2
A stand for supporting sound amplifiers, wherein the stand has a base for resting on a floor, an amplifier support platform on the base, the plane of said platform being slanted downwardly from front to rear, a back rest pivotally mounted on the base for pivoting between 0° and 90° to the plane of the platform, and cooperating stop means on the base and said back rest for stopping pivoting motion of the back rest beyond 90° to the plane of the platform, wherein the plane of the platform is below the plane of the back rest when the back rest is in a stored position lying adjacent the platform.
US08701890B2
A system of surgical instruments for use with at least a first implant and a second implant of the same type but different sizes is provided. The system includes a first container containing at least a first surgical instrument of a first type that is size specific and a second surgical instrument of a second type that is size specific; a second container containing at least a third surgical instrument of the first type and a fourth surgical instrument of the second type, wherein both the third and fourth instruments are of a second size that is different from the first size and that corresponds to the second implant; and a third container containing at least a fifth surgical instrument of a third type that is size independent.
US08701882B2
A container for goods having an axial dimension is provided, comprising a first end support having four corners and being oriented in a first plane, a second end support having four corners and being oriented in a second plane spaced axially from the first plane, at least two connecting rails having first and second ends, the first ends being removeably connected to the first end support and the second ends being removeably connected to the second end support, each rail being connected to a different corner of the first end support and a corresponding corner of the second end support, wherein at least one good may be suspended between and supported by the first end support and second end support.
US08701860B1
Systems, methods and devices for processing coins are presented herein. A coin processing system is disclosed which includes a housing with a coin input area for receiving a batch of coins, a controller with a communication interface operatively attached to the housing, and a coin processing unit for counting, discriminating, and/or valuing coins received from the coin input area. The coin processing system also includes a mobile coin receptacle removably disposed within the housing and configured to receive coins from the coin processing unit. The mobile coin receptacle is configured to wirelessly communicate information to the communication interface of the controller. The mobile coin receptacle can include one or more electrical contacts that mate with one or more electrical contacts on the housing to wirelessly communicate the information.
US08701852B2
An engagement system (10) for a fluid-coupling device (9) may include a first engagement member (31) and a second engagement member (15) that is in operation with the first engagement member (31). A working chamber (33) is disposed between and at least partially defined by the first engagement member (31) and the second engagement member (15). The working chamber (33) has an inlet port (118) and an outlet port (120). A fluid reservoir (35) is fluidically-coupled to the working chamber (33). A scavenge valve (11) is coupled between the working chamber (33) and the fluid reservoir (35) and adjusts the fluid flow through the outlet port (120). An engagement system (10) for a fluid-coupling device (9) may in addition to or alternatively include a working chamber (33) that includes a working chamber inlet port (118) that is along an outer perimeter (126) of the first engagement member (31). A valve (11) is coupled between the working chamber (33) and the fluid reservoir (35) and adjusts the fluid flow through the working chamber.
US08701850B2
A friction device assembly structure for an automatic transmission includes a first friction device and an end play adjustment element. The first friction device includes a plurality of discs and a plurality of plates which are alternately arranged and configured such that a frictional force is created between the discs and the plates by the pressing force of a piston. The end play adjustment element is provided on an end of the first friction device to adjust an end play defined between the first friction device and the piston. The end play adjustment element is hollow such that an inner diameter thereof is greater than an outermost diameter of a second friction device which is provided inside the first friction device. Thereby, the end play adjustment element is able to be assembled without any interference from the second friction device.
US08701845B2
A suspension device (S) comprises: an actuator (A) including a motion conversion mechanism (T) for converting rotational motion of a screw nut (1) to linear motion of a threaded shaft (2), and a motor (M) connected to the screw nut (1); and a fluid pressure damper (D) connected to the threaded shaft (2), wherein the threaded shaft (2) is formed in a cylindrical shape, a connecting shaft (30) for connecting a rod (31) or a cylinder (32) of the fluid pressure damper (D) to the threaded shaft (2) is inserted into the threaded shaft (2), and the connecting shaft (30) is connected to an end, opposite to the fluid pressure damper, of the threaded shaft (2). Accordingly, the connection between the actuator and the hydraulic damper is facilitated.
US08701843B2
A flywheel assembly for exercise devices includes a flywheel. A first disc and a second disc sequentially received in the flywheel and securely attached to each other. A control plate is rotatably sandwiched between the first disc and the second disc. Multiple magnetic devices are respectively and radially connected to the control plate. A shaft centrally extends through the first disc, the second disc and the flywheel, and laterally mounted onto the second disc, wherein the flywheel is rotatable relative to the first disc, the control plate with the magnetic devices and the second disc. A drive device is laterally mounted onto the second disc for driving the control plate and adjusting the damping to the flywheel when the control plate is rotated relative to the first disc and the second disc due to the operation from the drive device.
US08701841B2
Brake caliper bodies and brake calipers for disc brakes are provided.
US08701827B2
A climbing screen support system comprising a support rail fixable to a surface adjacent an edge of a structure; a mounting arm slidably securable to the rail so as to confine movement of the mounting arm in a linear direction along the support rail; and a climbing shoe attachable to an end of the mounting arm, wherein the support system is configured such that the mounting arm may be securely mounted to the support rail remote from the edge of the structure and subsequently slideable along the support rail such that the climbing shoe protrudes from the edge of the structure by a predetermined distance.
US08701823B2
A muffler of a motorcycle having an outside diameter greater than the outside diameter d1 of a rectilinear portion of a branch pipe is disposed at a transverse portion of an exhaust pipe. Since the muffler is formed to be roughly elliptic in sectional shape, the outside diameter of the muffler is represented by a major diameter da as the length in the direction of a major axis and a major diameter db as the length in the direction of a minor axis. When the muffler is disposed between a swing arm and a seat to be along the transverse portion of the exhaust pipe, the muffler can be disposed on the more vehicle front side while securing the capacity thereof. Therefore, protrusion of the muffler toward the rear of the vehicle is suppressed, and the external appearance of a vehicle rear portion is enhanced.
US08701810B2
A battery pack to be mounted on a vehicle. The battery pack has a battery stack. A cooling fan, a fan relay, and a main relay (−) are disposed on one side of the battery stack. A control module, a register, a main relay (+), and a pre-charge relay are disposed on the other side of the same. As a result of devices being disposed on both sides of the battery stack, the weight of the battery pack is adjusted to the neighborhood of the center of the battery pack.
US08701808B2
A series/parallel dual motor dual-clutch hybrid electrical driving unit for vehicle includes: a main traction motor (17), an integrated starter-generator (4), a differential (7), a main shaft (8), a first stage decelerating device (9), a primary clutch (16) and a first clutch (15). Said traction motor (17) is connected with said first stage decelerating device (9) via said first clutch (15). A series/parallel dual motor triple clutch hybrid electrical driving unit for vehicle further includes a second clutch (12) and a second stage decelerating device (5) based on the above described series/parallel dual motor dual-clutch hybrid electrical driving unit. The hybrid electrical driving unit according to the invention is compact in structure arrangement, high efficient and rational in connection. The arrangement based on this invention can be utilized to connect or disconnect each individual hybrid source and wheel, and by altering the power-output torques, the shift of operation modes and gear positions of the hybrid driving system can be further realized.
US08701796B2
A rotating control device is remotely hydraulically latched and unlatched with a docking station housing for use and removal, respectively. The system and method allows for interactive lubrication and cooling of the rotating control device, as needed, along with a supply of fluid for use with an active seal. A first sensor and a second sensor can be used to detect temperature, pressure and density of the supplied fluid at different locations and this data can be compared using a central processing unit (CPU). Also, a sensor can be used to detect the revolutions per minute of a rotating seal of the rotating control device and fluid can be provided to the rotating control device responsive to the detected revolutions per minute.
US08701786B2
Wellhead assemblies, seal assemblies, and methods of locking down an annulus seal disposed within an annulus between outer and inner wellhead members, are provided. A seal assembly is positioned in an annulus. An energizing member is axially translated downward to energize an annulus seal element and outwardly radially compress a high-strength lockdown member into contact with an inner diameter surface of a wellhead member. The wellhead member can include a set of wickers. During compression, the outer diameter surface of the lockdown member is plastically deformed onto the set of wickers.
US08701784B2
A method for controlling and coordinating the operation of a lifting device and a tongs device in removing and disassembling and/or installing and assembling a series of elongate members disposed within a wellbore involves sequentially sensing the presence of a series of joints and automatically triggering the lifting device and tongs device in response thereto. In some examples, the method senses the location of an upper joint to determine when the lifting device should begin decelerating prior to stopping the ascent of a lower joint at a target elevation. In some examples, the method includes control means for automatically skipping various joints.
US08701779B2
The invention relates to a valve device that is used in oil and gas wells. The valve device has an external housing (1), where at least one inlet (4) in the housing (1) is connected to an outlet (5) through a longitudinal bore in the housing longitudinal direction. Between the valve device's inlet and outlet there is mounted a valve seat (2) in the bore, where a valve body (3) shuts off the connection between the inlet and outlet. The valve body's position is controlled by a support (20), connected with a pressure-sensitive bellows device (6) comprising an upper and a lower bellows element (7, 71). When the lower bellows element is compressed in the valve device's axial direction, the compression will cause the two bellows elements'impact elements to be moved relative each other in order to lift the valve body out of abutment with the valve seat.
US08701776B2
A mechanical counting device for actuating a plurality of output devices, the device comprising: linear indexing means adapted to count a plurality of actuating signals and to cause actuation of the output devices when a predetermined number of actuating signals for each output device has been received, wherein the mechanical counting device is adapted to cause actuation of a particular output device when a different predetermined number of actuating signals has been received such that the output devices are sequentially actuable.
US08701768B2
Systems and methods for treating a subsurface formation are described herein. Some method include providing heat to a section of the formation from a plurality of heaters located in the formation, allowing the heat to transfer from the heaters to heat a portion of the section to a selected temperature to generate an in situ deasphalting fluid in the section, contacting at least a portion of the in situ deasphalting fluid with hydrocarbons in the section to remove at least some asphaltenes from the hydrocarbons in the section, and producing at least a portion of the deasphalted hydrocarbons from the formation. The in situ deasphalting fluid may include hydrocarbons having a boiling range distribution between 35° C. and 260° C. at 0.101 MPa. A majority of the hydrocarbons in the section may have a boiling point greater than 260° C. at 0.101 MPa.
US08701765B2
Gravel packing apparatus and method. The apparatus can include a conduit configured to extend between first and second wellbore intervals and through an isolation valve assembly separating the first and second intervals. A sliding sleeve can be configured to slide between an open position and a closed position. When the sliding sleeve is in the open position, it is configured to allow a flow of gravel slurry through the conduit between the first and second intervals, and when the sliding sleeve is in the closed position, it is configured to completely isolate the first and second intervals from each other.
US08701763B2
Method of treating a hydrocarbon-bearing formation having brine and treated hydrocarbon-bearing formations. The method includes contacting a hydrocarbon-bearing formation with a composition comprising solvent and a polymer. The polymer comprises divalent units represented by formula: (formula I); and a plurality of alkyleneoxy groups. In some embodiments, the solvent at least one of solubilizes or displaces the brine in the formation. In some embodiments, the solvent includes at least one of a polyol or polyol ether independently having from 2 to 25 carbon atoms and at least one of water, a monohydroxy alcohol, an ether, or a ketone, wherein the monohydroxy alcohol, the ether, and the ketone each independently have up to 4 carbon atoms. Hydrocarbon-bearing formations and proppants treated with the polymer are also disclosed.
US08701756B2
A snubbing plug is configured to be secured within a component of a mineral extraction system by an internal locking mechanism. In addition, the snubbing plug enables pressure equalization of regions above and below the plug before removal of the plug. Upon insertion of the snubbing plug into a well component, pressure may be equalized via fluid pathways through the snubbing plug. The pathways are sealed closed during snubbing operations and opened again when snubbing operations are complete. Manipulation of the fluid pathways may be accomplished via rotation of a load ring within the snubbing plug.
US08701755B2
A pump comprising: a pump barrel for use within a well; a reciprocating plunger disposed within the pump barrel and operatively engaging a removable connector adapted to flushly secure over the top of the plunger; said connector operatively engaging a pumping unit; the connector further comprising: an inner and outer portion with an upwardly disposed tapered edge between the inner and outer portions; and one or more tubular ports extending generally diagonally from the axis of the connector and adapted to expel fluids through hydraulic pressure resulting from the reciprocating action of the plunger and wherein said ports are annularly disposed between the upwardly disposed tapered edge and the inner portion and accessing an inner cavity of the connector; the connector further comprising an axial bore adapted to allow fluids to pass through the connector and further comprising one or more upper fluid bypass ports disposed on the inner portion.
US08701750B2
One or more embodiments of the present invention relates to a heat exchanger. The heat exchanger comprises a pair of header-tanks having at least one partition wall and at least one baffle; a plurality of tubes; and a plurality of fins. A communication hole is formed on the partition wall that is positioned at a region disposed between the baffle and one end of the header-tank adjacent to the baffle. Given that a distance from the baffle to the one end of the header-tank is 100%, 1˜4 communication holes are formed at positions on the partition wall which corresponds to an extent of 0˜50%, 65˜100%, or an extent of 0˜50% and an extent of 65˜100%.
US08701747B2
A heat exchanging system comprising circulating fluid through a tube coupled to an electronic component in a first part of a computing device and to a heat transfer plate in a second part of the computing device.
US08701744B2
A molding machine which allows a simplification of a sand filling operation, and the prevention of the formation of a bridge and an air channel in the sand tank, so that the sand filling operation of the molding machine is able to be performed steadily. The molding machine of the present invention includes: a sand tank for storing molding sand to be introduced to a molding flask; a pair of upper and lower sand filling nozzles to guide the molding sand in a horizontal direction, where the molding sand is supplied from a pair of upper and lower sand introducing parts which are located at the lower part of the sand tank; and at least one filter part with a plurality of air-injecting apertures on its entire body, which is attached to at least the entire inner surfaces of the pair of sand introducing parts; wherein the molding sand is fluidized by air injected through the air-injecting apertures of the filter part, and introduced to the molding flask through the sand filling nozzles.
US08701736B2
An inflation work station for inflating a tire-wheel assembly including a tire mounted to a wheel is disclosed. The inflation work station includes an inflation probe including a female portion and a male portion. The inflation work station further includes a movement actuator connected to a controller and the inflation probe. The movement actuator imparts movement to the male portion of the inflation probe to result in the online/offline orientation of the at least one inflation probe. The inflation workstation includes a pressurized fluid source connected to the inflation probe by way of a valve to permit or deny communication of a pressurized fluid through the inflation probe to a cavity formed by the tire-wheel assembly for inflating the tire-wheel assembly. A method is also disclosed.
US08701728B2
A process for preparing a copolymer of an acyclic conjugated diene and a cyclic conjugated diene using a polymerization catalyst system comprising a transition metal compound or a lanthanide metal compound, an alkylating agent, and an inorganic halide alcoholate, and rubber compositions and tires comprising the same. The copolymer contains at least 90% acyclic conjugated diene monomer, has a number average molecular weight of between 40,000 and 300,000, and has a cis-bond content of at least 92%.
US08701714B2
Abrasion resistant polymer pipe and a process for the production thereof. The pipe comprises a first, abrasion resistant inner layer (1) and a second, structural layer (2), which is placed on the outer side of the inner layer. The first and the second layers comprise extrudable polymer materials and they are preferably separated by an alarm layer which indicates wear or depletion of the inner layer. The pipe is suitable for use in the mining industry and generally for conducting liquid and gaseous fluids containing abrasive particles.
US08701713B2
The invention relates to a heating device for a device for transporting a fluid containing a hydrocarbon. The heating device comprises a rigid structure extending between two lateral walls, forming a space between the lateral walls. A flexible membrane comprising a heating structure extends into the space in order to define, in the space, an inner cavity and an outer cavity. Pumping structure designed to supply a fluid to the inner cavity, remove the fluid therefrom, or keep the fluid therein, in order to bring the membrane into contact with the transport device so as to heat same.
US08701710B2
An apparatus for dispensing gas from a container containing gas under pressure comprises an adjustable flow regulator and a valve, as well as a cowling and mounting ring.
US08701709B2
A water supply control system for use with a fire hydrant comprises a four-way valve assembly having a first inlet port for coupling to a nozzle of the fire hydrant via a fire hose, the four-way valve assembly operable to selectively open and close the inlet and outlet ports according to an operating mode of the four-way valve assembly, a stable and sturdy platform substantially supporting the weight of the four-way valve assembly, a flexible tether strap secured to the platform at a first end and having a fastener at a second end for releasably coupling to the fire hydrant, a status indicator mounted on the four-way valve assembly operable to provide a visual indication of the operation mode of the four-way valve assembly, and a scene light mounted on the four-way assembly operable to provide high-intensity illumination.
US08701707B2
A pressure control valve device with at least one inlet area and first and second outlet areas which can be connected by two poppet valves. A flow guide device (21), with inflow and outflow areas (22, 23) for guiding the fluid flowing from the inlet area in a defined manner in the direction of the second poppet valve, is located upstream of the second poppet valve, between the first and second outlet areas. The fluid in the flow guide device (21) passes in the area between the inflow and outflow areas (22, 23) through a plurality of channel areas distributed around the periphery of the flow guide device (21) and separated from one another, which are shaped at least approximately helically and impart an at least approximately vortex-like flow pattern to the fluid flowing in the direction of the second poppet valve downstream of the outflow area (23).
US08701704B2
The invention concerns a manifold comprising: an auxiliary block (3) having cassette feed ports (20) and cassette filtrate return ports (21) each emerging through a bearing surface (7) and, on a counter-bearing surface (8) situated on the opposite side to the bearing surface (7), first recesses into each of which emerges a cassette filtrate return port (21); a main block (2) on which is fastened the auxiliary block (3), having an inlet conduit (14) and a filtrate outlet conduit (15), cassette feed intermediate ports which communicate with the inlet conduit (14) and with a cassette feed port (20), conveying cut-outs each facing a recess, and cassette filtrate return intermediate ports which communicate with the filtrate outlet conduit (15) and with a cassette filtrate return port (21).
US08701700B2
An apparatus for emptying a sewage storage tank of a vehicle into a sewage disposal unit, the apparatus including: an extendible member coupled to the vehicle, the extendible member comprising a first end pivotally coupled to the vehicle and a second end for coupling to an outlet of a sewage conduit of the vehicle, the extendible member being movable between a retracted position and an extended position; and wherein the extendible member is pivotable and extendible for moving the outlet of the sewage conduit into communication with the inlet of the sewage disposal unit prior to opening the valve of the sewage storage tank.
US08701695B2
The present invention relates to a wastewater valve arrangement. The valve arrangement includes a first receptacle for receiving a filter to filter wastewater. A second receptacle receives the filtered wastewater. A valve is provided for impeding the egress of filtered wastewater from the second receptacle. In one embodiment, the valve is configured to be normally open, and is configured to permit the release and ingress of air relative to the second receptacle. The valve may include a float that defines a recess.
US08701689B2
Disclosed herein is a portico for saddle-shaped tents. The portico includes a drape that is suspended from the saddle-frame of the saddle-shaped tent. The portico also includes a portico-frame that has a horizontal beam, which beam is attached to the lower edge of the drape. The portico-frame may also include posts. In one embodiment of the invention, the portico acts as a joiner to join two adjacent saddle-shaped tents. The invention includes tents and compound tent-structures that incorporate the portico.
US08701688B2
A vent is provided for a tent or shelter. The vent is supported by a centrally located vent pole, the vent pole running lengthwise with the vent flap. The vent pole is formed of a construction that is resilient enough to support the vent during use, but is flexible enough so that the vent may be collapsed during storage.
US08701685B2
An eyelash extension system includes an extension strip with a backing and a plurality of eyelash extensions. Each extension has a proximal end and a distal end. The proximal end of each extension is joined to the backing and distal end of each extension extends away from the backing. The system also includes an extension tray with at least one curved extension attachment surface to receive the extension strip such that adhering the extension strip to the curved extension attachment surface spreads the distal ends of the extensions farther apart than the proximal ends of the extensions joined to the backing.
US08701679B2
Provided is a tobacco-free oral flavor delivery pouch product that provides and engaging and flavorful experience to a user. The pouch product includes a porous pouch wrapper and an inner filling material. The inner filling material can include a non-tobacco, botanical component, at least one functional ingredient and a solid flavor component dispersed throughout the inner filling material. The pouch product delivers multiple textures to the user's mouth.
US08701674B2
An immobilization device including an anterior component including a two-dimensional shaped section contoured to a shape of the human chest and an anterior outwardly bowed area relative to the two-dimensional shaped anterior section generally corresponding to the sternum of the wearer. The device also includes a posterior component including a two-dimensional shaped section contoured to a shape of the human back and a posterior outwardly bowed area relative to the two-dimensional shaped section corresponding to the spinal column of the wearer, with elongate cushion elements connected to and extending within a width of the posterior outwardly bowed area. A strapping system connects both the anterior and posterior components to one another.
US08701673B2
A one-piece molded bruxism treatment device which in upright orientation has top and bottom parts, including: an elongated band having a generally U-shape defining a closed front end part and legs extending rearward and adapted to be positioned around the outer surfaces of a person's upper gums and teeth, and two generally planar resiliently deformable bite pads oriented generally horizontally, each extending from one of the feet of the band medially toward the other.
US08701667B1
A patient interface device includes a support member, a sealing assembly attached to the support member, and a pair of contacting members. The contacting members are coupled to the support member on each side of the sealing assembly. The contacting members are each configured and arranged to contact the user over a limited contacting region, which corresponds to a junction of the orbicularis oris facial muscle, the zygomaticus facial muscle, and the risorius facial muscle.
US08701664B2
Apparatus (1) for relieving dyspnoea in an ambulatory exercising subject comprises a housing (3) to be worn on the subject, and within which a variable speed air blower motor (5) is located for delivering an air supply to the subject through a mouthpiece (10) at a pressure similar to average intrinsic positive end-expiratory pressure of the subject. A pressure transducer (25) in the mouthpiece (10) monitors the pressure during breathing cycles of the subject, and a control circuit (22) determines the average intrinsic positive end-expiratory pressure of the subject over five breathing cycles. The control circuit (22) operates the air blower motor (5) for delivering the air supply to the subject at a pressure similar to the determined average intrinsic positive end-expiratory pressure.
US08701657B2
In one aspect, a system for delivering nitric oxide to a patient can include a first gas source including nitrogen dioxide mixed in air or oxygen, a second gas source supplying compressed air, a ventilator coupled to the first and second gas sources, where the ventilator can be resistant to nitrogen dioxide, and where the ventilator provides a gas flow having a proper amount of nitrogen dioxide, one or more conversion devices operably coupled to the ventilator, where the conversion devices covert nitrogen dioxide into nitric oxide, and a patient interface operably coupled to the conversion devices, where the patient interface delivers nitric oxide to the patient.
US08701656B2
An inhaler (1) is proposed for delivering a preferably powdered formulation from a blister strip (3) having a plurality of blister pockets (4). The inhaler comprises a life span blocking device (31) which blocks opening of a cover (15) of the inhaler in a blocking state by means of locking element (39) interlocking the cover with a housing (19) of the inhaler.
US08701647B2
The invention provides a block splitter assembly comprising first lower and second upper opposed splitter blade assemblies. The splitter blade assemblies have a splitting blade and two or more first forming blades. One forming blade is disposed to the right of and one forming blade is disposed to the left of the first splitting blade. The forming blades have forming edges. The splitting blade has a splitting edge that is straight, and the splitting blade has a greater maximum vertical dimension than the maximum vertical dimension of the forming blades. The splitting edge of the first splitting blade is opposed to the splitting edge of the second splitting blade.
US08701639B2
An elongated electromagnetic railgun (1) adapted to propel a moving armature (30) through a bore (11) along the length of the railgun (1) from its breech end (21) to its muzzle end (22). The railgun (1) comprises two elongated mechanically rigid electrically conductive barrel sections (13), said sections (13) being spaced apart from each other along the length of the railgun (1). Mechanically coupled via a dielectric (18) to each barrel section (13) is an elongated current carrying rail (14) for providing electromagnetic propulsive force to the armature (30). The two rails (14) face each other across an elongated open channel, defining the bore (11). The two barrel sections (13) are electrically connected to each other at a maximum of one location of the railgun (1).
US08701626B2
A gasoline direct injection engine that has an injector directly injecting fuel into a combustion chamber, a spark plug, an intake valve, and an exhaust valve and generates power by reciprocating a piston in a cylinder, may include a cavity formed on a piston head and returning some flow of the fuel injected from the injector to the intake valve, and a channel formed around the cavity.
US08701610B2
An internal combustion engine having a cylinder head and a cylinder head cover, wherein in order to activate charge cycle valves, at least one rotatably mounted cam shaft is provided with at least one sliding cam which can be slid axially on the respective cam shaft, wherein the respective sliding cam has at least one slotted link section with at least one groove, wherein in order to bring about axial sliding of the respective sliding cam, an actuator is provided, and wherein after axial sliding on the respective cam shaft, the respective sliding cam can be latched in its axial relative position relative to a charge cycle valve to be activated by a locking device which has a first latching element with a plurality of latching depressions and at least one second latching element which interacts with the first latching element.
US08701608B2
A variable valve lift system for an internal combustion engine includes a roller rocker lift mechanism and a driving mechanism. A cam and a roller of the roller rocker lift mechanism cooperate with each other to control valve lift. The roller rocker lift mechanism includes a second rocker arm, wherein one end of the second rocker arm is connected with the driving mechanism by a rotation pin so as to create a straight-line displacement of the driving mechanism; the second rocker arm is provided with a guideway in the direction of the straight-line displacement; a rocker-arm pin of the roller rocker lift mechanism is slidably set in the guideway of the second rocker. According to actual work condition of the internal combustion engine, the valve lift is regulated by a motor; and continuous variable valve lift is provided from low speed to high speed.
US08701594B2
Rodent bait station assemblies and methods for bundling.
US08701593B2
A gas supply system for supplying a gas into a processing chamber for processing a substrate to be processed includes: a processing gas supply unit; a processing gas supply line; a first and a second processing gas branch line; a branch flow control unit; an additional gas supply unit; an additional gas supply line; a first and a second additional gas branch line; a flow path switching unit; and a control unit. Before processing the substrate to be processed, the control unit performs a pressure ratio control on the branch flow control unit while the processing gas supply unit supplies the processing gas. After the inner pressures of the first and the second processing gas branch line become stable, the control unit switches the pressure ratio control to a fixed pressure control, and then the additional gas supply unit supplies the additional gas.
US08701592B2
A mask frame includes a frame and a mask installed on the frame while being stretched in a first direction. The mask includes a deposition area including a plurality of deposition pattern portions, an edge unit formed to have a thickness greater than a thickness of the deposition area and including a first edge and a second edge that extend in the first direction on two sides of the deposition area, and two or more ribs formed to have a thickness greater than the thickness of the deposition area between deposition pattern portions adjacent to each other in a second direction perpendicular to the first direction.
US08701591B2
A dispensing container apparatus having a tubular container with a bottom end and a rotatable annular upper end connected to a tubular shaft, and a compression member associated with the tubular shaft which causes a material disposed within the containment region to communicate into the tubular shaft or into a containing area upon rotation of the rotatable annular upper end. A brush applicator removably fits into an open end of the tubular shaft for receiving paste to be dispensed via brush application. Also, the container apparatus includes a top member having paste-access holes sized and adapted to closely receive different threaded shaft sizes of fasteners. In one form, the top member is partially rotatable for closing the holes, and then further rotatable for moving the piston (and hence paste) within the container.
US08701581B2
A system and method protect a thruster assembly disposed with a pontoon of a semi-submersible drilling vessel during dry tow transport. A cover may be positioned over the thruster assembly and secured with the pontoon. A thruster cover support structure may be disposed with the pontoon. The thruster cover support structure may be a frame positioned around the pontoon for removable attachment with the thruster cover. The thruster cover support structure may be a bracket, ring or flange fixedly attached with the pontoon. The thruster cover may be removably disposed with the bracket, ring or flange, such as by bolting or welding. A spacer barge may be positioned below the pontoon between thruster assemblies for lifting the semi-submersible drilling vessel before placement of the spacer barge and semi-submersible vessel on the dry tow transporting vessel. The thruster assemblies may be elevated and in some embodiments positioned directly over the dry tow transporting vessel.
US08701579B2
An offshore wind turbine installation vessel, wherein the wind turbine is of the type to be installed on a foundation that is installed on the seabed prior to the installation of the wind turbine on the foundation, wherein the wind turbine is of the type with a vertical mast to be fitted with its lower end onto the foundation, wherein the vessel includes a non-jack-up type floating hull; and a crane structure extending upward from said hull. The crane structure is provided with a hoisting device having one or more wind turbine suspension elements and a wind turbine engagement device supported by the suspension elements and adapted to engage with said wind turbine. The hoisting device is adapted to support and to raise and lower in controllable manner at least the mast of the wind turbine while in vertical orientation.
US08701571B2
A rectangular pallet that is symmetrical about its two major axes. The pallet comprises a first plastics shell and a second plastics shell. The first plastics shell is formed with a flat rim, nine or more ground engaging feet subtending below the level of the rim, the feet being arranged in respective parallel spaced apart beams extending from front to back. The first plastics shell also has plural channels running from side to side intersecting the beams running from front to back to define the feet. The second plastics shell is essentially flat and formed with a flat rim. An internal network of partitions extends between the first and second plastics shells. The rims of the first and second plastics shells are sealed to each other to form a clam and to enclose the network of partitions within the clam. In other aspects, the invention concerns a method and a system for forming the pallet.
US08701568B2
A worksurface assembly includes a support structure and a top portion that is movable relative to the support structure. The worksurface assembly may include a mounting rail configured to support various accessory units. A utility supply system is provided, and the top portion of the worksurface assembly may be moved to provide access to the utility supply system. A mechanism provides for controlled movement of the top portion of the worksurface assembly relative to the support structure.
US08701567B1
A portable workstation is provided that includes a lower work surface and an upper work surface, where the upper work surface is supported by at least one support member that maintains the upper work surface and the lower work surface in a tiered, spaced apart relationship with one another. The portable workstation includes at least one pair of fastening members positioned on the underside of the lower work surface for securing the workstation across horizontal stabilizing bars of an exercise machine. The mounting members may be adjustable straps, such as Velcro® strap, for removeably coupling the workstation to the exercise machine.
US08701564B2
A self-steering system for a radial bogie of a railroad vehicle is provided. The self-steering system includes a plurality of links which connect the leading and trailing wheelsets to the bogie frame. Each of the links is adapted to provide a smaller degree of movement between the link and the wheelset at one end and a larger degree of movement between the link and the bogie frame at the other end.
US08701557B2
Embodiments of an initiator support assembly that includes an initiator housing including an initiator cavity system are generally described herein. In some embodiments, a bridge substrate is positioned within the initiator cavity. The bridge substrate includes a substrate base including a uniform first planar surface and an opposed second surface. The bridge substrate further includes a first bridge contact extending over the substrate base. The first bridge contact is substantially flush with the first planar surface. A second bridge contact extends over the substrate base. The second bridge contact is substantially flush with the first planar surface. The first and second bridge contacts and the uniform first planar surface form a continuous planar mounting surface. An explosive charge, positioned within the initiator cavity, includes a charge mounting surface that is continuously coupled in surface-to-surface contact across the continuous planar mounting surface.
US08701547B2
A coffee maker has a water reservoir, an in-line water heater, a brew basket for receiving coffee grounds, a water passage between the water reservoir and the brew basket, a water level sensor located in the water reservoir, a water level indicator, and a controller in communication with the water level sensor and the water level indicator. The passage passes through the in-line water heater for delivering heated water to the brew basket. The controller activates the water level indicator in response to a signal from the water level sensor. A method of making coffee in the coffee maker includes determining, in the controller, an operating condition for a coffee bean grinder and operating the coffee bean grinder based on the operating condition to grind coffee beans and produce a quantity of ground coffee beans.
US08701542B2
An artillery ammunition loading system (100), configured to load ammunitions includes at least one projectile in a cannon or a howitzer (11). The ammunition loading system includes a first mobile loader (102a) for loading projectiles and a second mobile loader (102b) for loading propelling charges, which alternatively and at least partially automatically feed the cannon or howitzer (11) for each firing cycle.
US08701531B2
A food processing dicing method and assembly is disclosed. The food processing dicing assembly may comprise a dicing element having multiple dicing openings through which food may pass, a frame configured to selectively retain the dicing element, and a management tool having multiple projections sized to be received by the dicing openings, the management tool may include at least one coupling element for releasably coupling the management tool to at least one of the dicing element and the frame.
US08701523B2
A coupling device for a hybrid power plant operates in at least two electrical/internal-combustion-electrical modes designed for a vehicle, whereby the coupling device includes a first drive shaft that is coupled to an electric motor and a second drive shaft that is coupled to an internal combustion engine. The coupling device includes at least one primary shaft that can be coupled by first or second transmission element to the first or the second drive shaft under the action of selection element that can assume a first position and a second position in such a way that: In the first position of the selection element, the primary shaft is coupled to the first or to the second drive shaft by the first or the second transmission element; and In the second position of the selection element, the primary shaft is coupled to the first drive shaft by the first transmission element.
US08701522B2
A pendant type adjustment pedal apparatus includes an adjustment accelerator pedal that adjust a pedal clearance by the rotation of a motor, and an adjustment brake pedal that receives the rotation of motor through a rotary drive cable. Accordingly, convenience in adjusting a pedal clearance is provided, and particularly, adjustment accelerator pedal achieves a vibration mode in addition to a foot effort mode, which is an eco mode, by an electric mode generating device, such as a solenoid or a linear motor. Therefore, it is possible to improve fuel efficiency and to provide a danger recognition function using an accelerator pedal.
US08701515B2
A drive assembly for a motor vehicle with a clutch device on the input side. The drive assembly includes a transmission having input and output shafts, loose and fixed gearwheels, shifting devices for coupling the loose gearwheels to the transmission shafts, a power take-off (PTO) gearwheel that can be driven by the input of the clutch device, and a PTO clutch for engaging the PTO gearwheel in the torque flow. The PTO clutch is arranged in the torque flow after and axially adjacent a starting and shifting clutch. The clutch device comprises the starting and shifting clutch, the PTO clutch and two actuators. The starting and shifting clutch is a friction clutch and the PTO clutch is a claw clutch. The two clutches have a clutch cover and a common actuator housing, and the coupling device of the PTO clutch is arranged radially outside the clutch cover.
US08701513B2
A linear actuator and housing assembly may be used to increase motor performance and dissipate excess thermal energy. One embodiment relates to an actuator housing and an electric motor coupled to the actuator housing, where the electric motor is disposed within the actuator housing such that there is a close proximity between the actuator housing and the motor. A linear actuator assembly may be operably coupled to the electric motor, where the linear actuator assembly is disposed within the actuator housing and a thermally conductive material is disposed between the actuator housing and motor.
US08701507B2
An improved metering apparatus includes a metering pipette (1) and a metering attachment (2). The metering pipette (1) includes a metering body (3) and a piston (4) which is longitudinally displaceably guided in the metering body (3). The metering attachment (2) is connected or connectable to the metering pipette (1). It includes a stop body (16) having a stop (17) for the piston (4) (FIG. 2).
US08701504B2
In a sample-processing system that includes one or more function modules and one or more buffer units each combined as a pair with one of the function modules, in case of device stoppage due to failure, since a number of sample racks are held in the buffers, resetting involves a huge amount of time for storage of the racks. In addition, if the system configuration includes a plurality of buffer units, the resetting time increases with the number of buffer units. Sample rack ID reading means is provided in each buffer unit and during resetting, IDs of the sample racks in the buffer unit are read in the buffer unit. The buffer unit then uses the read information to make an inquiry to a control unit as to transport destinations of each sample rack. After this, sample processing based on transport destination instructions from the control unit is restarted using the buffer unit as a restarting position.
US08701501B2
An ultrasonic flowmeter that measures flow velocity of a measured fluid by propagating ultrasonic waves through a measuring flow path with a rectangular cross section through which the measured fluid flows and the measured fluid that flows through the measuring flow path. The measuring flow path is provided with partition plates so that they are in parallel with the flow direction of the measured fluid. Simultaneously, the partition plates are placed in parallel with wall surfaces such that flow velocity distribution between opposing wall surfaces of the measuring flow path is more symmetrical with respect to the center of the flow direction of the measured fluid.
US08701499B2
A method and an apparatus detects defects in raceways of bearing shells and rolling elements of ceramic hybrid bearings. To enable the detection of such defects without falsifying measuring values of the ceramic hybrid bearings installed, the outer or inner ferromagnetic bearing shell of the ceramic hybrid bearing is magnetically coded in at least a partial area and the magnetic coding of the bearing shell is used as generator for testing the raceways of the bearing shells and the ceramic rolling elements by inverse magnetostriction.
US08701485B2
A sensor device includes: a sensor component including a package, connection terminals including first connection terminals on a terminal forming surface of the package and a sensor element housed in the package; a resin part covering the sensor component; and mounting leads including a one-end part coupled to one first connection terminal in the resin part so that a main surface thereof faces a main surface of the one first connection terminal face; an intermediate part extending toward a mounting surface of the sensor device from the one-end part; and another-end part externally exposed from the resin part. The sensor component is tilted or orthogonal relative to the mounting surface. The connection terminals are provided along one of the sides forming an outline of the terminal forming surface, the one side being tilted or orthogonal with respect to the mounting surface. The intermediate part includes an angled part.
US08701476B2
A sensor assembly for use in a vehicle. The sensor assembly has a housing for receiving a substrate. Terminals with substrate mating portions are provided in the housing. The substrate has components mounted thereon and plated openings which extend therethrough. The plated openings are provided in electrical engagement with the terminals. The openings are provided to mechanically and electrically engage the resilient contact portions of the terminals. The substrate mating portions are releasably pressure fit within the plated openings to allow the substrate to be removed and replaced as needed. The substrate mating portions maintain the electrical and mechanical connection between the substrate mating portions and the plated openings when the sensor assembly is exposed to vibration.
US08701475B2
An air flow measuring device includes a housing, flow sensor, and a humidity sensor. The housing defines a bypass flow passage through which intake it passes. A part of intake air is taken into the bypass flow passage to pass through the bypass flow passage. The flow sensor includes a sensing part disposed in the bypass flow passage, and produces a signal which is in accordance with the flow rate of intake air as a result of heat transfer between intake air taken into the bypass flow passage and the sensing part. The humidity sensor includes a sensing part exposed to the intake passage, and projects from an outer wall of the housing into the intake passage. The humidity sensor produces a signal which is in accordance with humidity of intake ail flowing through the intake passage.
US08701474B2
An air flow measuring device includes a housing, a sensor, and a projection portion. The housing defines a bypass flow passage through which taken-in intake air passes and which has an outlet that opens into an intake passage toward a downstream side of a mainstream of intake air. The sensor is accommodated in the bypass flow passage to produce an electrical signal as a result of heat transfer between the taken-in intake air and the sensor. The projection portion is provided on an outer wall of the housing on a downstream side of the outlet in the mainstream and extends outward of the housing. A projection-portion projected region and an outlet projected region, which are formed respectively by projecting the projection portion and the outlet perpendicularly onto a projection plane that is perpendicular to a direction of the mainstream, overlap with each other.
US08701472B2
The spatial center of mass and a mass of an object can be determined by orientating the suspended object in at least two different spatial positions and measuring the orientation of the object in each of the different spatial positions the forces acting on the suspension devices because of the suspended object, the forces acting on the suspension devices being resolved into three independent force components. A center of area of the object and the associated force effect lines are determined for each of the at least two spatial positions, the center of area of the respective spatial position being determined with an inclined tension compensation of the suspension devices. The spatial center of mass is determined by superimposing at least two force effect lines.
US08701469B2
A sensor system utilizing flexible electronics for on-line real-time high-sensitivity sampling, monitoring, and analysis of a parameter or analyte of interest in a fluid or in or on a solid is provided. The flexible substrate sensor system comprises a plurality of sensors, a flexible substrate, a network, and a connection between the sensors and the network, wherein the network reads out or collects information from the sensors. The network can be onboard, connected by via a physical connection to the sensors and the flexible substrate, or external to the sensors and flexible substrate, connected via a telemetric or wireless connection to the sensors. The flexible substrate sensor system can be deployed in systems that conduct or distribute fluids or solids, such as distribution systems (municipal water systems, oil or gas pipeline systems), industrial systems (production facilities, piping, and storage systems), and large structures (dams, bridges, walkways, buildings).
US08701445B2
An optical fiber manufacturing apparatus for manufacturing an optical fiber by drawing a optical fiber preform, including: a drawing furnace having therein a muffle tube into which the optical fiber preform is inserted and heating the optical fiber preform; and a first seal member which is disposed at an insert side of the drawing furnace so as to be coaxial with the drawing furnace and which seals the optical fiber preform inserted into an opening formed at the center thereof, wherein the first seal member includes a plurality of inner-circumference slits formed in the inner circumference thereof and a plurality of outer-circumference slits formed in the outer circumference thereof.
US08701444B2
A parison mold assembly for a press-and-blow glassware forming machine includes a neck ring for molding a finish portion of a parison, a parison mold for molding a body portion of the parison, and a plunger for insertion through the neck ring into the parison mold for pressing a hot glass gob against inner surfaces of the neck ring and the parison mold. The plunger has an outer surface of revolution around a central axis, including a first portion disposed within the neck ring when the plunger is fully inserted through the neck ring into the parison mold, a second portion spaced from the first portion, and a transition third portion extending between the first and second portions.
US08701434B2
A cooling device includes a cooling unit (10) penetrated by a fluid to be cooled, in particular hydraulic oil, and a filter unit (12) for filtering the fluid. The filter unit (12) extends along a longitudinal side of the cooling unit (10). A fluid collecting space (16) is arranged between the filter unit (12) and the cooling unit (10). The fluid collecting space (16) has a uniform flow cross-section and is at least partially closed against the filter unit (12) by a concavely curved limitating wall (36). The optimized fluid guidance obtained results in a uniformization of speed, while at the same time avoiding cavities and turbulences to ensure a trouble-free and energetically favorable operation of the cooling device.
US08701428B2
A refrigerator and a method for controlling the same are provided. More particularly, the refrigerator is provided with a dispenser having a cavity for a cup, dispenser doors that open and close the cavity, and a door driver positioned in the dispenser that drives the dispenser doors. The dispenser doors may be automatically controlled to open and close, thereby improving cleanliness and an exterior appearance of the refrigerator by reducing dust accumulation in the dispenser during periods of non-use.
US08701427B2
A method for controlling a vehicle HVAC system to automatically defog a windshield glass and to prevent fogging or condensation of the windshield glass. In-cabin air temperature and relative humidity are measured and used to determine a dewpoint. Further, ambient or outside temperature is measured. If windshield wipers are being used or if the cabin air temperature is less than a predetermined temperature, the ambient air temperature value is used as a glass temperature, otherwise the glass temperature is determined from the ambient air temperature and vehicle speed. A fog margin, which is a measure of the likelihood of fog formation, is based upon the difference between dewpoint and the windshield glass temperature. The fog margin is used to control the HVAC system to anticipate and respond to potential fogging conditions.
US08701425B2
A refrigeration air conditioning system having a moisture adsorption means regenerated by discharged condensation heat or other discharged heat of a low temperature range in the refrigeration cycle, and exerting stable cooling performance even at a dry-bulb temperature of 0° C. or less. A desiccant rotor, holds an adsorbent having pore sizes of, for example, 1-1.4 nm in a space at a predetermined temperature range of a dry-bulb temperature of 0° C. or less. Forming of frost on an evaporator is prevented by supplying the dehumidified air by the desiccant rotor to the evaporator disposed on a leeward side thereof in a freezing room as the desiccant rotor is rotated, while the adsorbent having adsorbed moisture is dried and recovers its adsorbing ability by supplying the air dried by discharged heat from a condenser on the windward side thereof to the desiccant rotor outside of the freezing room.
US08701419B2
A system includes a multi-tube fuel nozzle having an inlet plate and a plurality of tubes adjacent the inlet plate. The inlet plate includes a plurality of apertures, and each aperture includes an inlet feature. Each tube of the plurality of tubes is coupled to an aperture of the plurality of apertures. The multi-tube fuel nozzle includes a differential configuration of inlet features among the plurality of tubes.
US08701418B2
A gas turbine engine is provided and includes a combustor having a first interior in which a first fuel is combustible, the first fuel including natural gas and/or a blend of natural gas and alternate gas receivable by a fuel circuit from an external source, a turbine, a transition zone, including a second interior in which a second fuel, the second fuel including an unblended supply of the alternate gas receivable by the fuel circuit from the external source, and the products of the combustion of the first fuel are combustible, and a plurality of fuel injectors, which are structurally supported by the transition zone and coupled to the fuel circuit, and which are configured to supply the second fuel to the second interior in any one of a single axial stage, multiple axial stages, a single axial circumferential stage and multiple axial circumferential stages.
US08701417B2
A head part of an annular gas turbine combustion chamber including: an end wall with a passage opening for accommodating a burner, the end wall including a set back portion adjacent the passage opening; a heat shield covering a back side of the end wall which faces towards the combustion chamber, the heat shield including a protruding portion shaped to cooperate with the set back portion of the end wall; and a burner collar adapted to fit within the passage opening and receive a burner, the burner collar including a protruding portion radially protruding from an outer surface of the burner collar; wherein the head part of the annular gas turbine combustion chamber is configured such that in an installed configuration the protruding portion of the burner collar is held between the protruding portion of the heat shield and the set back portion of the end wall.
US08701405B2
A method of starting a heat engine includes exposing an element of the heat engine to a source of thermal energy provided by a temperature difference between a heat source having a first temperature and a heat sink having a second temperature that is lower than the first temperature. The element is formed from a first shape memory alloy having a crystallographic phase changeable between austenite and martensite at a first transformation temperature in response to the temperature difference between the heat source and the heat sink. The method further includes changing the crystallographic phase of the first shape memory alloy to thereby convert thermal energy to mechanical energy, and inducing initial movement of the element in a desired operational direction to thereby start the heat engine.
US08701404B2
In one embodiment according to the invention, there is provided a method for generating electrical energy using a thermal cycle of a working gas. The method comprises using the motion of a piston in a cylinder, containing the working gas performing the thermal cycle, to electromagnetically induce current in an electrical circuit coupled to the cylinder; using the electrical circuit to store the electrical energy, produced by the current induced in the electrical circuit, in an electrical storage device; and using the electrical energy stored in the electrical storage device to electromagnetically provide a motive force to the piston. Cyclically using the electrical circuit to store the electrical energy and using the stored energy to provide a motive force to the piston effect a net positive average power transfer into the electrical storage device over the course of the thermal cycle.
